Who is online?
In total there are 13 users online :: 0 Registered, 0 Hidden and 13 Guests :: 1 Bot


[ View the whole list ]

Most users ever online was 115 on Wed 03 Jul 2019, 3:20 pm
Latest topics
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 4:39 pm by Admin

» R.D SOUZA Saved by faith
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 4:36 pm by Admin

» NUGGET Today's Devotional
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 4:07 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 4:03 pm by Admin

» +Dev+ Michael D. Inman Pastor
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 4:00 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 3:16 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 2:05 pm by Admin

» Mrs. P's Haven of Refuge Inspirational
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 2:03 pm by Admin

» servant @ TWO LISTENERS
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 12:33 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 12:29 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 12:28 pm by Admin

» Daily Disciples
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 12:27 pm by Admin

» The Mark started implants in their hands to replace cash, credit cards
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 11:52 am by Admin

» BIRTH PANGS – Series of Powerful Earthquakes Volcano's Strike Around the Globe
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 9:47 am by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 9:40 am by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyToday at 12:07 am by Admin

» My Manna
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyYesterday at 11:10 pm by Admin

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyYesterday at 11:09 pm by Admin

» Another Look at Footwashing
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyYesterday at 10:47 pm by Admin

» 12 Proverbs to Start Memorizing Today
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 EmptyYesterday at 10:22 pm by Admin



Page 38 of 38 Previous  1 ... 20 ... 36, 37, 38

Go down


Post  Admin on Thu 07 Jul 2011, 3:44 pm

Daily Bible Reading from BibleStudyTools.com
July 7, 2011 - King James Version
Mark 14:1-31
1 After two days was the feast of the passover, and of unleavened bread: and the chief priests and the scribes sought how they might take him by craft, and put him to death . 2 But they said , Not on the feast day, lest there be an uproar of the people. 3 And being in Bethany in the house of Simon the leper, as he sat at meat , there came a woman having an alabaster box of ointment of spikenard very precious; and she brake the box, and poured it on his head. 4 And there were some that had indignation within themselves, and said , Why was this waste of the ointment made ? 5 For it might have been sold for more than three hundred pence, and have been given to the poor. And they murmured against her. 6 And Jesus said , Let her alone ; why trouble ye her? she hath wrought a good work on me. 7 For ye have the poor with you always, and whensoever ye will ye may do them good: but me ye have not always. 8 She hath done what she could : she is come aforehand to anoint my body to the burying. 9 Verily I say unto you, Wheresoever this gospel shall be preached throughout the whole world, this also that she hath done shall be spoken of for a memorial of her. 10 And Judas Iscariot, one of the twelve, went unto the chief priests, to betray him unto them. 11 And when they heard it, they were glad , and promised to give him money. And he sought how he might conveniently betray him. 12 And the first day of unleavened bread, when they killed the passover, his disciples said unto him, Where wilt thou that we go and prepare that thou mayest eat the passover? 13 And he sendeth forth two of his disciples, and saith unto them, Go ye into the city, and there shall meet you a man bearing a pitcher of water: follow him. 14 And wheresoever he shall go in , say ye to the goodman of the house , The Master saith , Where is the guestchamber, where I shall eat the passover with my disciples? 15 And he will shew you a large upper room furnished and prepared: there make ready for us. 16 And his disciples went forth , and came into the city, and found as he had said unto them: and they made ready the passover. 17 And in the evening he cometh with the twelve. 18 And as they sat and did eat , Jesus said , Verily I say unto you , One of you which eateth with me shall betray me. 19 And they began to be sorrowful , and to say unto him one by one , Is it I? and another said, Is it I? 20 And he answered and said unto them, It is one of the twelve, that dippeth with me in the dish. 21 The Son of man indeed goeth , as it is written of him: but woe to that man by whom the Son of man is betrayed ! good were it for that man if he had never been born . 22 And as they did eat , Jesus took bread, and blessed , and brake it, and gave to them, and said , Take , eat : this is my body. 23 And he took the cup, and when he had given thanks , he gave it to them: and they all drank of it. 24 And he said unto them, This is my blood of the new testament, which is shed for many. 25 Verily I say unto you, I will drink no more of the fruit of the vine, until that day that I drink it new in the kingdom of God. 26 And when they had sung an hymn , they went out into the mount of Olives. 27 And Jesus saith unto them , All ye shall be offended because of me this night: for it is written , I will smite the shepherd, and the sheep shall be scattered . 28 But after that I am risen , I will go before you into Galilee. 29 But Peter said unto him, Although all shall be offended , yet will not I. 30 And Jesus saith unto him, Verily I say unto thee, That this day, even in this night, before the cock crow twice, thou shalt deny me thrice. 31 But he spake the more vehemently , If I should die with thee, I will not deny thee in any wise. Likewise also said they all. 1 Kings 8:1-66
1 Then Solomon assembled the elders of Israel, and all the heads of the tribes, the chief of the fathers of the children of Israel, unto king Solomon in Jerusalem, that they might bring up the ark of the covenant of the LORD out of the city of David, which is Zion. 2 And all the men of Israel assembled themselves unto king Solomon at the feast in the month Ethanim, which is the seventh month. 3 And all the elders of Israel came , and the priests took up the ark. 4 And they brought up the ark of the LORD, and the tabernacle of the congregation, and all the holy vessels that were in the tabernacle, even those did the priests and the Levites bring up . 5 And king Solomon, and all the congregation of Israel, that were assembled unto him, were with him before the ark, sacrificing sheep and oxen, that could not be told nor numbered for multitude. 6 And the priests brought in the ark of the covenant of the LORD unto his place, into the oracle of the house, to the most holy place, even under the wings of the cherubims. 7 For the cherubims spread forth their two wings over the place of the ark, and the cherubims covered the ark and the staves thereof above. 8 And they drew out the staves, that the ends of the staves were seen out in the holy place before the oracle, and they were not seen without: and there they are unto this day. 9 There was nothing in the ark save the two tables of stone, which Moses put there at Horeb, when the LORD made a covenant with the children of Israel, when they came out of the land of Egypt. 10 And it came to pass, when the priests were come out of the holy place, that the cloud filled the house of the LORD, 11 So that the priests could not stand to minister because of the cloud: for the glory of the LORD had filled the house of the LORD. 12 Then spake Solomon, The LORD said that he would dwell in the thick darkness. 13 I have surely built thee an house to dwell in, a settled place for thee to abide in for ever. 14 And the king turned his face about , and blessed all the congregation of Israel: (and all the congregation of Israel stood Wink 15 And he said , Blessed be the LORD God of Israel, which spake with his mouth unto David my father, and hath with his hand fulfilled it, saying , 16 Since the day that I brought forth my people Israel out of Egypt, I chose no city out of all the tribes of Israel to build an house, that my name might be therein; but I chose David to be over my people Israel. 17 And it was in the heart of David my father to build an house for the name of the LORD God of Israel. 18 And the LORD said unto David my father, Whereas it was in thine heart to build an house unto my name, thou didst well that it was in thine heart. 19 Nevertheless thou shalt not build the house; but thy son that shall come forth out of thy loins, he shall build the house unto my name. 20 And the LORD hath performed his word that he spake , and I am risen up in the room of David my father, and sit on the throne of Israel, as the LORD promised , and have built an house for the name of the LORD God of Israel. 21 And I have set there a place for the ark, wherein is the covenant of the LORD, which he made with our fathers, when he brought them out of the land of Egypt. 22 And Solomon stood before the altar of the LORD in the presence of all the congregation of Israel, and spread forth his hands toward heaven: 23 And he said , LORD God of Israel, there is no God like thee, in heaven above, or on earth beneath, who keepest covenant and mercy with thy servants that walk before thee with all their heart: 24 Who hast kept with thy servant David my father that thou promisedst him: thou spakest also with thy mouth, and hast fulfilled it with thine hand, as it is this day. 25 Therefore now, LORD God of Israel, keep with thy servant David my father that thou promisedst him, saying , There shall not fail thee a man in my sight to sit on the throne of Israel; so that thy children take heed to their way, that they walk before me as thou hast walked before me. 26 And now, O God of Israel, let thy word, I pray thee, be verified , which thou spakest unto thy servant David my father. 27 But will God indeed dwell on the earth? behold, the heaven and heaven of heavens cannot contain thee; how much less this house that I have builded ? 28 Yet have thou respect unto the prayer of thy servant, and to his supplication, O LORD my God, to hearken unto the cry and to the prayer, which thy servant prayeth before thee to day: 29 That thine eyes may be open toward this house night and day, even toward the place of which thou hast said , My name shall be there: that thou mayest hearken unto the prayer which thy servant shall make toward this place. 30 And hearken thou to the supplication of thy servant, and of thy people Israel, when they shall pray toward this place: and hear thou in heaven thy dwelling place: and when thou hearest , forgive . 31 If any man trespass against his neighbour, and an oath be laid upon him to cause him to swear , and the oath come before thine altar in this house: 32 Then hear thou in heaven, and do , and judge thy servants, condemning the wicked, to bring his way upon his head; and justifying the righteous, to give him according to his righteousness. 33 When thy people Israel be smitten down before the enemy , because they have sinned against thee, and shall turn again to thee, and confess thy name, and pray , and make supplication unto thee in this house: 34 Then hear thou in heaven, and forgive the sin of thy people Israel, and bring them again unto the land which thou gavest unto their fathers. 35 When heaven is shut up , and there is no rain, because they have sinned against thee; if they pray toward this place, and confess thy name, and turn from their sin, when thou afflictest them: 36 Then hear thou in heaven, and forgive the sin of thy servants, and of thy people Israel, that thou teach them the good way wherein they should walk , and give rain upon thy land, which thou hast given to thy people for an inheritance. 37 If there be in the land famine, if there be pestilence, blasting, mildew, locust, or if there be caterpiller; if their enemy besiege them in the land of their cities; whatsoever plague, whatsoever sickness there be; 38 What prayer and supplication soever be made by any man, or by all thy people Israel, which shall know every man the plague of his own heart, and spread forth his hands toward this house: 39 Then hear thou in heaven thy dwelling place, and forgive , and do , and give to every man according to his ways, whose heart thou knowest ; (for thou, even thou only, knowest the hearts of all the children of men;) 40 That they may fear thee all the days that they live in the land which thou gavest unto our fathers. 41 Moreover concerning a stranger, that is not of thy people Israel, but cometh out of a far country for thy name's sake; 42 (For they shall hear of thy great name, and of thy strong hand, and of thy stretched out arm;) when he shall come and pray toward this house; 43 Hear thou in heaven thy dwelling place, and do according to all that the stranger calleth to thee for: that all people of the earth may know thy name, to fear thee, as do thy people Israel; and that they may know that this house, which I have builded , is called by thy name. 44 If thy people go out to battle against their enemy , whithersoever thou shalt send them, and shall pray unto the LORD toward the city which thou hast chosen , and toward the house that I have built for thy name: 45 Then hear thou in heaven their prayer and their supplication, and maintain their cause. 46 If they sin against thee, (for there is no man that sinneth not,) and thou be angry with them, and deliver them to the enemy , so that they carry them away captives unto the land of the enemy , far or near; 47 Yet if they shall bethink themselves in the land whither they were carried captives , and repent , and make supplication unto thee in the land of them that carried them captives , saying , We have sinned , and have done perversely , we have committed wickedness ; 48 And so return unto thee with all their heart, and with all their soul, in the land of their enemies , which led them away captive , and pray unto thee toward their land, which thou gavest unto their fathers, the city which thou hast chosen , and the house which I have built for thy name: 49 Then hear thou their prayer and their supplication in heaven thy dwelling place, and maintain their cause, 50 And forgive thy people that have sinned against thee, and all their transgressions wherein they have transgressed against thee, and give them compassion before them who carried them captive , that they may have compassion on them: 51 For they be thy people, and thine inheritance, which thou broughtest forth out of Egypt, from the midst of the furnace of iron: 52 That thine eyes may be open unto the supplication of thy servant, and unto the supplication of thy people Israel, to hearken unto them in all that they call for unto thee. 53 For thou didst separate them from among all the people of the earth, to be thine inheritance, as thou spakest by the hand of Moses thy servant, when thou broughtest our fathers out of Egypt, O Lord GOD. 54 And it was so, that when Solomon had made an end of praying all this prayer and supplication unto the LORD, he arose from before the altar of the LORD, from kneeling on his knees with his hands spread up to heaven. 55 And he stood , and blessed all the congregation of Israel with a loud voice, saying , 56 Blessed be the LORD, that hath given rest unto his people Israel, according to all that he promised : there hath not failed one word of all his good promise, which he promised by the hand of Moses his servant. 57 The LORD our God be with us, as he was with our fathers: let him not leave us, nor forsake us: 58 That he may incline our hearts unto him, to walk in all his ways, and to keep his commandments, and his statutes, and his judgments, which he commanded our fathers. 59 And let these my words, wherewith I have made supplication before the LORD, be nigh unto the LORD our God day and night, that he maintain the cause of his servant, and the cause of his people Israel at all times , as the matter shall require: 60 That all the people of the earth may know that the LORD is God, and that there is none else. 61 Let your heart therefore be perfect with the LORD our God, to walk in his statutes, and to keep his commandments, as at this day. 62 And the king, and all Israel with him, offered sacrifice before the LORD. 63 And Solomon offered a sacrifice of peace offerings, which he offered unto the LORD, two and twenty thousand oxen, and an hundred and twenty thousand sheep. So the king and all the children of Israel dedicated the house of the LORD. 64 The same day did the king hallow the middle of the court that was before the house of the LORD: for there he offered burnt offerings, and meat offerings, and the fat of the peace offerings: because the brasen altar that was before the LORD was too little to receive the burnt offerings, and meat offerings, and the fat of the peace offerings. 65 And at that time Solomon held a feast, and all Israel with him, a great congregation, from the entering in of Hamath unto the river of Egypt, before the LORD our God, seven days and seven days, even fourteen days. 66 On the eighth day he sent the people away : and they blessed the king, and went unto their tents joyful and glad of heart for all the goodness that the LORD had done for David his servant, and for Israel his people. Hosea 9:17-17
17 My God will cast them away , because they did not hearken unto him: and they shall be wanderers among the nations. Hosea 10:1-15
1 Israel is an empty vine, he bringeth forth fruit unto himself: according to the multitude of his fruit he hath increased the altars; according to the goodness of his land they have made goodly images. 2 Their heart is divided ; now shall they be found faulty : he shall break down their altars, he shall spoil their images. 3 For now they shall say , We have no king, because we feared not the LORD; what then should a king do to us? 4 They have spoken words, swearing falsely in making a covenant: thus judgment springeth up as hemlock in the furrows of the field. 5 The inhabitants of Samaria shall fear because of the calves of Bethaven: for the people thereof shall mourn over it, and the priests thereof that rejoiced on it, for the glory thereof, because it is departed from it. 6 It shall be also carried unto Assyria for a present to king Jareb: Ephraim shall receive shame, and Israel shall be ashamed of his own counsel. 7 As for Samaria, her king is cut off as the foam upon the water. 8 The high places also of Aven, the sin of Israel, shall be destroyed : the thorn and the thistle shall come up on their altars; and they shall say to the mountains, Cover us; and to the hills, Fall on us. 9 O Israel, thou hast sinned from the days of Gibeah: there they stood : the battle in Gibeah against the children of iniquity did not overtake them. 10 It is in my desire that I should chastise them; and the people shall be gathered against them, when they shall bind themselves in their two furrows. 11 And Ephraim is as an heifer that is taught , and loveth to tread out the corn; but I passed over upon her fair neck: I will make Ephraim to ride ; Judah shall plow , and Jacob shall break his clods . 12 Sow to yourselves in righteousness, reap in mercy; break up your fallow ground: for it is time to seek the LORD, till he come and rain righteousness upon you. 13 Ye have plowed wickedness, ye have reaped iniquity; ye have eaten the fruit of lies: because thou didst trust in thy way, in the multitude of thy mighty men. 14 Therefore shall a tumult arise among thy people, and all thy fortresses shall be spoiled , as Shalman spoiled Betharbel in the day of battle: the mother was dashed in pieces upon her children. 15 So shall Bethel do unto you because of your great wickedness: in a morning shall the king of Israel utterly be cut off . The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Wed 06 Jul 2011, 11:34 am

Daily Bible Reading from BibleStudyTools.com
July 6, 2011 - King James Version
Mark 13:14-37
14 But when ye shall see the abomination of desolation, spoken of by Daniel the prophet, standing where it ought not, (let him that readeth understand ,) then let them that be in Judaea flee to the mountains: 15 And let him that is on the housetop not go down into the house, neither enter therein, to take any thing out of his house: 16 And let him that is in the field not turn back again for to take up his garment. 17 But woe to them that are with child, and to them that give suck in those days! 18 And pray ye that your flight be not in the winter. 19 For in those days shall be affliction, such as was not from the beginning of the creation which God created unto this time, neither shall be . 20 And except that the Lord had shortened those days, no flesh should be saved : but for the elect's sake, whom he hath chosen , he hath shortened the days. 21 And then if any man shall say to you, Lo , here is Christ; or, lo , he is there; believe him not: 22 For false Christs and false prophets shall rise , and shall shew signs and wonders, to seduce , if it were possible, even the elect. 23 But take ye heed : behold , I have foretold you all things. 24 But in those days, after that tribulation, the sun shall be darkened , and the moon shall not give her light, 25 And the stars of heaven shall fall , and the powers that are in heaven shall be shaken . 26 And then shall they see the Son of man coming in the clouds with great power and glory. 27 And then shall he send his angels, and shall gather together his elect from the four winds, from the uttermost part of the earth to the uttermost part of heaven. 28 Now learn a parable of the fig tree; When her branch is yet tender, and putteth forth leaves, ye know that summer is near: 29 So ye in like manner, when ye shall see these things come to pass , know that it is nigh, even at the doors. 30 Verily I say unto you, that this generation shall not pass , till all these things be done . 31 Heaven and earth shall pass away : but my words shall not pass away . 32 But of that day and that hour knoweth no man, no, not the angels which are in heaven, neither the Son, but the Father. 33 Take ye heed , watch and pray : for ye know not when the time is . 34 For the Son of man is as a man taking a far journey, who left his house, and gave authority to his servants, and to every man his work, and commanded the porter to watch . 35 Watch ye therefore: for ye know not when the master of the house cometh , at even, or at midnight, or at the cockcrowing, or in the morning: 36 Lest coming suddenly he find you sleeping . 37 And what I say unto you I say unto all, Watch . 1 Kings 7:1-51
1 But Solomon was building his own house thirteen years, and he finished all his house. 2 He built also the house of the forest of Lebanon; the length thereof was an hundred cubits, and the breadth thereof fifty cubits, and the height thereof thirty cubits, upon four rows of cedar pillars, with cedar beams upon the pillars. 3 And it was covered with cedar above upon the beams, that lay on forty five pillars, fifteen in a row. 4 And there were windows in three rows, and light was against light in three ranks. 5 And all the doors and posts were square , with the windows: and light was against light in three ranks. 6 And he made a porch of pillars; the length thereof was fifty cubits, and the breadth thereof thirty cubits: and the porch was before them: and the other pillars and the thick beam were before them. 7 Then he made a porch for the throne where he might judge , even the porch of judgment: and it was covered with cedar from one side of the floor to the other. 8 And his house where he dwelt had another court within the porch, which was of the like work. Solomon made also an house for Pharaoh's daughter, whom he had taken to wife, like unto this porch. 9 All these were of costly stones, according to the measures of hewed stones, sawed with saws, within and without, even from the foundation unto the coping, and so on the outside toward the great court. 10 And the foundation was of costly stones, even great stones, stones of ten cubits, and stones of eight cubits. 11 And above were costly stones, after the measures of hewed stones, and cedars. 12 And the great court round about was with three rows of hewed stones, and a row of cedar beams, both for the inner court of the house of the LORD, and for the porch of the house. 13 And king Solomon sent and fetched Hiram out of Tyre. 14 He was a widow's son of the tribe of Naphtali, and his father was a man of Tyre, a worker in brass: and he was filled with wisdom, and understanding, and cunning to work all works in brass. And he came to king Solomon, and wrought all his work. 15 For he cast two pillars of brass, of eighteen cubits high apiece : and a line of twelve cubits did compass either of them about . 16 And he made two chapiters of molten brass, to set upon the tops of the pillars: the height of the one chapiter was five cubits, and the height of the other chapiter was five cubits: 17 And nets of checker work, and wreaths of chain work, for the chapiters which were upon the top of the pillars; seven for the one chapiter, and seven for the other chapiter. 18 And he made the pillars, and two rows round about upon the one network, to cover the chapiters that were upon the top, with pomegranates: and so did he for the other chapiter. 19 And the chapiters that were upon the top of the pillars were of lily work in the porch, four cubits. 20 And the chapiters upon the two pillars had pomegranates also above, over against the belly which was by the network: and the pomegranates were two hundred in rows round about upon the other chapiter. 21 And he set up the pillars in the porch of the temple: and he set up the right pillar, and called the name thereof Jachin: and he set up the left pillar, and called the name thereof Boaz. 22 And upon the top of the pillars was lily work: so was the work of the pillars finished . 23 And he made a molten sea, ten cubits from the one brim to the other: it was round all about, and his height was five cubits: and a line of thirty cubits did compass it round about. 24 And under the brim of it round about there were knops compassing it, ten in a cubit, compassing the sea round about: the knops were cast in two rows, when it was cast . 25 It stood upon twelve oxen, three looking toward the north, and three looking toward the west, and three looking toward the south, and three looking toward the east: and the sea was set above upon them, and all their hinder parts were inward. 26 And it was an hand breadth thick, and the brim thereof was wrought like the brim of a cup, with flowers of lilies: it contained two thousand baths. 27 And he made ten bases of brass; four cubits was the length of one base, and four cubits the breadth thereof, and three cubits the height of it. 28 And the work of the bases was on this manner: they had borders, and the borders were between the ledges: 29 And on the borders that were between the ledges were lions, oxen, and cherubims: and upon the ledges there was a base above: and beneath the lions and oxen were certain additions made of thin work. 30 And every base had four brasen wheels, and plates of brass: and the four corners thereof had undersetters: under the laver were undersetters molten , at the side of every addition. 31 And the mouth of it within the chapiter and above was a cubit: but the mouth thereof was round after the work of the base, a cubit and an half: and also upon the mouth of it were gravings with their borders, foursquare , not round. 32 And under the borders were four wheels; and the axletrees of the wheels were joined to the base: and the height of a wheel was a cubit and half a cubit. 33 And the work of the wheels was like the work of a chariot wheel: their axletrees, and their naves, and their felloes, and their spokes, were all molten . 34 And there were four undersetters to the four corners of one base: and the undersetters were of the very base itself. 35 And in the top of the base was there a round compass of half a cubit high: and on the top of the base the ledges thereof and the borders thereof were of the same. 36 For on the plates of the ledges thereof, and on the borders thereof, he graved cherubims, lions, and palm trees, according to the proportion of every one, and additions round about. 37 After this manner he made the ten bases: all of them had one casting, one measure, and one size. 38 Then made he ten lavers of brass: one laver contained forty baths: and every laver was four cubits: and upon every one of the ten bases one laver. 39 And he put five bases on the right side of the house, and five on the left side of the house: and he set the sea on the right side of the house eastward over against the south. 40 And Hiram made the lavers, and the shovels, and the basons. So Hiram made an end of doing all the work that he made king Solomon for the house of the LORD: 41 The two pillars, and the two bowls of the chapiters that were on the top of the two pillars; and the two networks, to cover the two bowls of the chapiters which were upon the top of the pillars; 42 And four hundred pomegranates for the two networks, even two rows of pomegranates for one network, to cover the two bowls of the chapiters that were upon the pillars; 43 And the ten bases, and ten lavers on the bases; 44 And one sea, and twelve oxen under the sea; 45 And the pots, and the shovels, and the basons: and all these vessels, which Hiram made to king Solomon for the house of the LORD, were of bright brass. 46 In the plain of Jordan did the king cast them, in the clay ground between Succoth and Zarthan. 47 And Solomon left all the vessels unweighed, because they were exceeding many: neither was the weight of the brass found out . 48 And Solomon made all the vessels that pertained unto the house of the LORD: the altar of gold, and the table of gold, whereupon the shewbread was, 49 And the candlesticks of pure gold, five on the right side, and five on the left, before the oracle, with the flowers, and the lamps, and the tongs of gold, 50 And the bowls, and the snuffers, and the basons, and the spoons, and the censers of pure gold; and the hinges of gold, both for the doors of the inner house, the most holy place, and for the doors of the house, to wit, of the temple. 51 So was ended all the work that king Solomon made for the house of the LORD. And Solomon brought in the things which David his father had dedicated; even the silver, and the gold, and the vessels, did he put among the treasures of the house of the LORD. Hosea 9:1-16
1 Rejoice not, O Israel, for joy, as other people: for thou hast gone a whoring from thy God, thou hast loved a reward upon every cornfloor . 2 The floor and the winepress shall not feed them, and the new wine shall fail in her. 3 They shall not dwell in the LORD'S land; but Ephraim shall return to Egypt, and they shall eat unclean things in Assyria. 4 They shall not offer wine offerings to the LORD, neither shall they be pleasing unto him: their sacrifices shall be unto them as the bread of mourners; all that eat thereof shall be polluted : for their bread for their soul shall not come into the house of the LORD. 5 What will ye do in the solemn day, and in the day of the feast of the LORD? 6 For, lo, they are gone because of destruction: Egypt shall gather them up , Memphis shall bury them: the pleasant places for their silver, nettles shall possess them: thorns shall be in their tabernacles. 7 The days of visitation are come , the days of recompence are come ; Israel shall know it: the prophet is a fool, the spiritual man is mad , for the multitude of thine iniquity, and the great hatred. 8 The watchman of Ephraim was with my God: but the prophet is a snare of a fowler in all his ways, and hatred in the house of his God. 9 They have deeply corrupted themselves, as in the days of Gibeah: therefore he will remember their iniquity, he will visit their sins. 10 I found Israel like grapes in the wilderness; I saw your fathers as the firstripe in the fig tree at her first time: but they went to Baalpeor, and separated themselves unto that shame; and their abominations were according as they loved . 11 As for Ephraim, their glory shall fly away like a bird, from the birth , and from the womb, and from the conception. 12 Though they bring up their children, yet will I bereave them, that there shall not be a man left: yea, woe also to them when I depart from them! 13 Ephraim, as I saw Tyrus, is planted in a pleasant place: but Ephraim shall bring forth his children to the murderer . 14 Give them, O LORD: what wilt thou give ? give them a miscarrying womb and dry breasts. 15 All their wickedness is in Gilgal: for there I hated them: for the wickedness of their doings I will drive them out of mine house, I will love them no more : all their princes are revolters . 16 Ephraim is smitten , their root is dried up , they shall bear no fruit: yea, though they bring forth , yet will I slay even the beloved fruit of their womb. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Tjjmzjlcmwmklpcgkbfrdksdljkphffpwvldzzgzwhjlbpv_rjlgrcjngglt

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Tue 05 Jul 2011, 4:54 pm

Daily Bible Reading from BibleStudyTools.com
July 5, 2011 - King James Version
Mark 13:1-13
1 And as he went out of the temple, one of his disciples saith unto him, Master, see what manner of stones and what buildings are here! 2 And Jesus answering said unto him, Seest thou these great buildings? there shall not be left one stone upon another, that shall not be thrown down . 3 And as he sat upon the mount of Olives over against the temple, Peter and James and John and Andrew asked him privately , 4 Tell us, when shall these things be ? and what shall be the sign when all these things shall be fulfilled ? 5 And Jesus answering them began to say , Take heed lest any man deceive you: 6 For many shall come in my name, saying , I am Christ; and shall deceive many. 7 And when ye shall hear of wars and rumours of wars, be ye not troubled : for such things must needs be ; but the end shall not be yet. 8 For nation shall rise against nation, and kingdom against kingdom: and there shall be earthquakes in divers places, and there shall be famines and troubles: these are the beginnings of sorrows. 9 But take heed to yourselves: for they shall deliver you up to councils; and in the synagogues ye shall be beaten : and ye shall be brought before rulers and kings for my sake, for a testimony against them. 10 And the gospel must first be published among all nations. 11 But when they shall lead you, and deliver you up , take no thought beforehand what ye shall speak , neither do ye premeditate : but whatsoever shall be given you in that hour, that speak ye: for it is not ye that speak , but the Holy Ghost. 12 Now the brother shall betray the brother to death, and the father the son; and children shall rise up against their parents, and shall cause them to be put to death . 13 And ye shall be hated of all men for my name's sake : but he that shall endure unto the end, the same shall be saved . 1 Kings 6:1-38
1 And it came to pass in the four hundred and eightieth year after the children of Israel were come out of the land of Egypt, in the fourth year of Solomon's reign over Israel, in the month Zif, which is the second month, that he began to build the house of the LORD. 2 And the house which king Solomon built for the LORD, the length thereof was threescore cubits, and the breadth thereof twenty cubits, and the height thereof thirty cubits. 3 And the porch before the temple of the house, twenty cubits was the length thereof, according to the breadth of the house; and ten cubits was the breadth thereof before the house. 4 And for the house he made windows of narrow lights. 5 And against the wall of the house he built chambers round about, against the walls of the house round about, both of the temple and of the oracle: and he made chambers round about: 6 The nethermost chamber was five cubits broad, and the middle was six cubits broad, and the third was seven cubits broad: for without in the wall of the house he made narrowed rests round about, that the beams should not be fastened in the walls of the house. 7 And the house, when it was in building , was built of stone made ready before it was brought thither: so that there was neither hammer nor axe nor any tool of iron heard in the house, while it was in building . 8 The door for the middle chamber was in the right side of the house: and they went up with winding stairs into the middle chamber, and out of the middle into the third. 9 So he built the house, and finished it; and covered the house with beams and boards of cedar. 10 And then he built chambers against all the house, five cubits high: and they rested on the house with timber of cedar. 11 And the word of the LORD came to Solomon, saying , 12 Concerning this house which thou art in building , if thou wilt walk in my statutes, and execute my judgments, and keep all my commandments to walk in them; then will I perform my word with thee, which I spake unto David thy father: 13 And I will dwell among the children of Israel, and will not forsake my people Israel. 14 So Solomon built the house, and finished it. 15 And he built the walls of the house within with boards of cedar, both the floor of the house, and the walls of the cieling: and he covered them on the inside with wood, and covered the floor of the house with planks of fir. 16 And he built twenty cubits on the sides of the house, both the floor and the walls with boards of cedar: he even built them for it within, even for the oracle, even for the most holy place. 17 And the house, that is, the temple before it, was forty cubits long. 18 And the cedar of the house within was carved with knops and open flowers: all was cedar; there was no stone seen . 19 And the oracle he prepared in the house within, to set there the ark of the covenant of the LORD. 20 And the oracle in the forepart was twenty cubits in length, and twenty cubits in breadth, and twenty cubits in the height thereof: and he overlaid it with pure gold; and so covered the altar which was of cedar. 21 So Solomon overlaid the house within with pure gold: and he made a partition by the chains of gold before the oracle; and he overlaid it with gold. 22 And the whole house he overlaid with gold, until he had finished all the house: also the whole altar that was by the oracle he overlaid with gold. 23 And within the oracle he made two cherubims of olive tree, each ten cubits high. 24 And five cubits was the one wing of the cherub, and five cubits the other wing of the cherub: from the uttermost part of the one wing unto the uttermost part of the other were ten cubits. 25 And the other cherub was ten cubits: both the cherubims were of one measure and one size. 26 The height of the one cherub was ten cubits, and so was it of the other cherub. 27 And he set the cherubims within the inner house: and they stretched forth the wings of the cherubims, so that the wing of the one touched the one wall, and the wing of the other cherub touched the other wall; and their wings touched one another in the midst of the house. 28 And he overlaid the cherubims with gold. 29 And he carved all the walls of the house round about with carved figures of cherubims and palm trees and open flowers, within and without. 30 And the floor of the house he overlaid with gold, within and without. 31 And for the entering of the oracle he made doors of olive tree: the lintel and side posts were a fifth part of the wall. 32 The two doors also were of olive tree; and he carved upon them carvings of cherubims and palm trees and open flowers, and overlaid them with gold, and spread gold upon the cherubims, and upon the palm trees. 33 So also made he for the door of the temple posts of olive tree, a fourth part of the wall. 34 And the two doors were of fir tree: the two leaves of the one door were folding, and the two leaves of the other door were folding. 35 And he carved thereon cherubims and palm trees and open flowers: and covered them with gold fitted upon the carved work . 36 And he built the inner court with three rows of hewed stone, and a row of cedar beams. 37 In the fourth year was the foundation of the house of the LORD laid , in the month Zif: 38 And in the eleventh year, in the month Bul, which is the eighth month, was the house finished throughout all the parts thereof, and according to all the fashion of it. So was he seven years in building it. Hosea 8:1-14
1 Set the trumpet to thy mouth. He shall come as an eagle against the house of the LORD, because they have transgressed my covenant, and trespassed against my law. 2 Israel shall cry unto me, My God, we know thee. 3 Israel hath cast off the thing that is good: the enemy shall pursue him. 4 They have set up kings , but not by me: they have made princes , and I knew it not: of their silver and their gold have they made them idols, that they may be cut off . 5 Thy calf, O Samaria, hath cast thee off; mine anger is kindled against them: how long will it be ere they attain to innocency? 6 For from Israel was it also: the workman made it; therefore it is not God: but the calf of Samaria shall be broken in pieces. 7 For they have sown the wind, and they shall reap the whirlwind: it hath no stalk: the bud shall yield no meal: if so be it yield , the strangers shall swallow it up . 8 Israel is swallowed up : now shall they be among the Gentiles as a vessel wherein is no pleasure. 9 For they are gone up to Assyria, a wild ass alone by himself: Ephraim hath hired lovers. 10 Yea, though they have hired among the nations, now will I gather them, and they shall sorrow a little for the burden of the king of princes. 11 Because Ephraim hath made many altars to sin , altars shall be unto him to sin . 12 I have written to him the great things of my law, but they were counted as a strange thing . 13 They sacrifice flesh for the sacrifices of mine offerings, and eat it; but the LORD accepteth them not; now will he remember their iniquity, and visit their sins: they shall return to Egypt. 14 For Israel hath forgotten his Maker , and buildeth temples; and Judah hath multiplied fenced cities: but I will send a fire upon his cities, and it shall devour the palaces thereof. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Bdfclbpqcdcypzqtyjkmsyvspbyzfkkzdgpslltldfqpzdq_fqyjsdqhjjyg

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Sun 03 Jul 2011, 11:27 am

Daily Bible Reading from BibleStudyTools.com
July 3, 2011 - King James Version
Mark 12:1-27
1 And he began to speak unto them by parables. A certain man planted a vineyard, and set an hedge about it, and digged a place for the winefat, and built a tower, and let it out to husbandmen, and went into a far country . 2 And at the season he sent to the husbandmen a servant, that he might receive from the husbandmen of the fruit of the vineyard. 3 And they caught him, and beat him, and sent him away empty. 4 And again he sent unto them another servant; and at him they cast stones , and wounded him in the head , and sent him away shamefully handled . 5 And again he sent another; and him they killed , and many others ; beating some , and killing some . 6 Having yet therefore one son, his wellbeloved, he sent him also last unto them, saying , They will reverence my son. 7 But those husbandmen said among themselves, This is the heir; come , let us kill him, and the inheritance shall be ours. 8 And they took him, and killed him, and cast him out of the vineyard. 9 What shall therefore the lord of the vineyard do ? he will come and destroy the husbandmen, and will give the vineyard unto others. 10 And have ye not read this scripture; The stone which the builders rejected is become the head of the corner: 11 This was the Lord's doing , and it is marvellous in our eyes? 12 And they sought to lay hold on him, but feared the people: for they knew that he had spoken the parable against them: and they left him, and went their way . 13 And they send unto him certain of the Pharisees and of the Herodians, to catch him in his words. 14 And when they were come , they say unto him, Master, we know that thou art true, and carest for no man: for thou regardest not the person of men, but teachest the way of God in truth: Is it lawful to give tribute to Caesar, or not? 15 Shall we give , or shall we not give ? But he, knowing their hypocrisy, said unto them, Why tempt ye me? bring me a penny, that I may see it. 16 And they brought it. And he saith unto them, Whose is this image and superscription? And they said unto him, Caesar's. 17 And Jesus answering said unto them, Render to Caesar the things that are Caesar's, and to God the things that are God's. And they marvelled at him. 18 Then come unto him the Sadducees, which say there is no resurrection; and they asked him, saying , 19 Master, Moses wrote unto us, If a man's brother die , and leave his wife behind him, and leave no children, that his brother should take his wife, and raise up seed unto his brother. 20 Now there were seven brethren: and the first took a wife, and dying left no seed. 21 And the second took her, and died , neither left he any seed: and the third likewise. 22 And the seven had her, and left no seed: last of all the woman died also. 23 In the resurrection therefore, when they shall rise , whose wife shall she be of them? for the seven had her to wife. 24 And Jesus answering said unto them, Do ye not therefore err , because ye know not the scriptures, neither the power of God? 25 For when they shall rise from the dead, they neither marry , nor are given in marriage ; but are as the angels which are in heaven. 26 And as touching the dead, that they rise : have ye not read in the book of Moses, how in the bush God spake unto him, saying , I am the God of Abraham, and the God of Isaac, and the God of Jacob? 27 He is not the God of the dead, but the God of the living : ye therefore do greatly err . 1 Kings 3:1-28
1 And Solomon made affinity with Pharaoh king of Egypt, and took Pharaoh's daughter, and brought her into the city of David, until he had made an end of building his own house, and the house of the LORD, and the wall of Jerusalem round about. 2 Only the people sacrificed in high places, because there was no house built unto the name of the LORD, until those days. 3 And Solomon loved the LORD, walking in the statutes of David his father: only he sacrificed and burnt incense in high places. 4 And the king went to Gibeon to sacrifice there; for that was the great high place: a thousand burnt offerings did Solomon offer upon that altar. 5 In Gibeon the LORD appeared to Solomon in a dream by night: and God said , Ask what I shall give thee. 6 And Solomon said , Thou hast shewed unto thy servant David my father great mercy, according as he walked before thee in truth, and in righteousness, and in uprightness of heart with thee; and thou hast kept for him this great kindness, that thou hast given him a son to sit on his throne, as it is this day. 7 And now, O LORD my God, thou hast made thy servant king instead of David my father: and I am but a little child: I know not how to go out or come in . 8 And thy servant is in the midst of thy people which thou hast chosen , a great people, that cannot be numbered nor counted for multitude. 9 Give therefore thy servant an understanding heart to judge thy people, that I may discern between good and bad: for who is able to judge this thy so great a people? 10 And the speech pleased the Lord, that Solomon had asked this thing. 11 And God said unto him, Because thou hast asked this thing, and hast not asked for thyself long life; neither hast asked riches for thyself, nor hast asked the life of thine enemies ; but hast asked for thyself understanding to discern judgment; 12 Behold, I have done according to thy words: lo, I have given thee a wise and an understanding heart; so that there was none like thee before thee, neither after thee shall any arise like unto thee. 13 And I have also given thee that which thou hast not asked , both riches, and honour: so that there shall not be any among the kings like unto thee all thy days. 14 And if thou wilt walk in my ways, to keep my statutes and my commandments, as thy father David did walk , then I will lengthen thy days. 15 And Solomon awoke ; and, behold, it was a dream. And he came to Jerusalem, and stood before the ark of the covenant of the LORD, and offered up burnt offerings, and offered peace offerings, and made a feast to all his servants. 16 Then came there two women, that were harlots , unto the king, and stood before him. 17 And the one woman said , O my lord, I and this woman dwell in one house; and I was delivered of a child with her in the house. 18 And it came to pass the third day after that I was delivered , that this woman was delivered also: and we were together; there was no stranger with us in the house, save we two in the house. 19 And this woman's child died in the night; because she overlaid it. 20 And she arose at midnight , and took my son from beside me, while thine handmaid slept, and laid it in her bosom, and laid her dead child in my bosom. 21 And when I rose in the morning to give my child suck , behold, it was dead : but when I had considered it in the morning, behold, it was not my son, which I did bear . 22 And the other woman said , Nay; but the living is my son, and the dead is thy son. And this said , No; but the dead is thy son, and the living is my son. Thus they spake before the king. 23 Then said the king, The one saith , This is my son that liveth, and thy son is the dead : and the other saith , Nay; but thy son is the dead , and my son is the living. 24 And the king said , Bring me a sword. And they brought a sword before the king. 25 And the king said , Divide the living child in two, and give half to the one, and half to the other. 26 Then spake the woman whose the living child was unto the king, for her bowels yearned upon her son, and she said , O my lord, give her the living child , and in no wise slay it. But the other said , Let it be neither mine nor thine, but divide it. 27 Then the king answered and said , Give her the living child , and in no wise slay it: she is the mother thereof. 28 And all Israel heard of the judgment which the king had judged ; and they feared the king: for they saw that the wisdom of God was in him, to do judgment. Hosea 6:1-11
1 Come , and let us return unto the LORD: for he hath torn , and he will heal us; he hath smitten , and he will bind us up . 2 After two days will he revive us: in the third day he will raise us up , and we shall live in his sight. 3 Then shall we know , if we follow on to know the LORD: his going forth is prepared as the morning; and he shall come unto us as the rain, as the latter and former rain unto the earth. 4 O Ephraim, what shall I do unto thee? O Judah, what shall I do unto thee? for your goodness is as a morning cloud, and as the early dew it goeth away . 5 Therefore have I hewed them by the prophets; I have slain them by the words of my mouth: and thy judgments are as the light that goeth forth . 6 For I desired mercy, and not sacrifice; and the knowledge of God more than burnt offerings. 7 But they like men have transgressed the covenant: there have they dealt treacherously against me. 8 Gilead is a city of them that work iniquity, and is polluted with blood. 9 And as troops of robbers wait for a man, so the company of priests murder in the way by consent : for they commit lewdness. 10 I have seen an horrible thing in the house of Israel: there is the whoredom of Ephraim, Israel is defiled . 11 Also, O Judah, he hath set an harvest for thee, when I returned the captivity of my people. Hosea 7:1-2
1 When I would have healed Israel, then the iniquity of Ephraim was discovered , and the wickedness of Samaria: for they commit falsehood; and the thief cometh in , and the troop of robbers spoileth without. 2 And they consider not in their hearts that I remember all their wickedness: now their own doings have beset them about ; they are before my face. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Jssqrfbmqsqwbnmdwthkzwczbfwnjhhnsvbzrrdrsjvvjtf_mwpnqcwynnpb Daily Bible Reading from BibleStudyTools.com
July 2, 2011 - King James Version
Mark 11:15-33

15 And they come to Jerusalem: and Jesus went into the temple, and began to cast out them that sold and bought in the temple, and overthrew the tables of the moneychangers, and the seats of them that sold doves; 16 And would not suffer that any man should carry any vessel through the temple. 17 And he taught , saying unto them, Is it not written , My house shall be called of all nations the house of prayer? but ye have made it a den of thieves. 18 And the scribes and chief priests heard it, and sought how they might destroy him: for they feared him, because all the people was astonished at his doctrine. 19 And when even was come , he went out of the city. 20 And in the morning, as they passed by , they saw the fig tree dried up from the roots. 21 And Peter calling to remembrance saith unto him, Master, behold, the fig tree which thou cursedst is withered away . 22 And Jesus answering saith unto them, Have faith in God. 23 For verily I say unto you, That whosoever shall say unto this mountain, Be thou removed , and be thou cast into the sea; and shall not doubt in his heart, but shall believe that those things which he saith shall come to pass ; he shall have whatsoever he saith . 24 Therefore I say unto you, What things soever ye desire , when ye pray , believe that ye receive them, and ye shall have them. 25 And when ye stand praying , forgive , if ye have ought against any: that your Father also which is in heaven may forgive you your trespasses. 26 But if ye do not forgive , neither will your Father which is in heaven forgive your trespasses. 27 And they come again to Jerusalem: and as he was walking in the temple, there come to him the chief priests, and the scribes, and the elders, 28 And say unto him, By what authority doest thou these things? and who gave thee this authority to do these things? 29 And Jesus answered and said unto them, I will also ask of you one question, and answer me, and I will tell you by what authority I do these things. 30 The baptism of John, was it from heaven, or of men? answer me. 31 And they reasoned with themselves, saying , If we shall say , From heaven; he will say , Why then did ye not believe him? 32 But if we shall say , Of men; they feared the people: for all men counted John, that he was a prophet indeed. 33 And they answered and said unto Jesus, We cannot tell . And Jesus answering saith unto them, Neither do I tell you by what authority I do these things. 1 Kings 2:1-46

1 Now the days of David drew nigh that he should die ; and he charged Solomon his son, saying , 2 I go the way of all the earth: be thou strong therefore, and shew thyself a man; 3 And keep the charge of the LORD thy God, to walk in his ways, to keep his statutes, and his commandments, and his judgments, and his testimonies, as it is written in the law of Moses, that thou mayest prosper in all that thou doest , and whithersoever thou turnest thyself: 4 That the LORD may continue his word which he spake concerning me, saying , If thy children take heed to their way, to walk before me in truth with all their heart and with all their soul, there shall not fail thee (said he) a man on the throne of Israel. 5 Moreover thou knowest also what Joab the son of Zeruiah did to me, and what he did to the two captains of the hosts of Israel, unto Abner the son of Ner, and unto Amasa the son of Jether, whom he slew , and shed the blood of war in peace, and put the blood of war upon his girdle that was about his loins, and in his shoes that were on his feet. 6 Do therefore according to thy wisdom, and let not his hoar head go down to the grave in peace. 7 But shew kindness unto the sons of Barzillai the Gileadite, and let them be of those that eat at thy table: for so they came to me when I fled because of Absalom thy brother. 8 And, behold, thou hast with thee Shimei the son of Gera, a Benjamite of Bahurim, which cursed me with a grievous curse in the day when I went to Mahanaim: but he came down to meet me at Jordan, and I sware to him by the LORD, saying , I will not put thee to death with the sword. 9 Now therefore hold him not guiltless : for thou art a wise man, and knowest what thou oughtest to do unto him; but his hoar head bring thou down to the grave with blood. 10 So David slept with his fathers, and was buried in the city of David. 11 And the days that David reigned over Israel were forty years: seven years reigned he in Hebron, and thirty and three years reigned he in Jerusalem. 12 Then sat Solomon upon the throne of David his father; and his kingdom was established greatly. 13 And Adonijah the son of Haggith came to Bathsheba the mother of Solomon. And she said , Comest thou peaceably? And he said , Peaceably. 14 He said moreover, I have somewhat to say unto thee. And she said , Say on . 15 And he said , Thou knowest that the kingdom was mine, and that all Israel set their faces on me, that I should reign : howbeit the kingdom is turned about , and is become my brother's: for it was his from the LORD. 16 And now I ask one petition of thee, deny me not. And she said unto him, Say on . 17 And he said , Speak , I pray thee, unto Solomon the king, (for he will not say thee nay ,) that he give me Abishag the Shunammite to wife. 18 And Bathsheba said , Well; I will speak for thee unto the king. 19 Bathsheba therefore went unto king Solomon, to speak unto him for Adonijah. And the king rose up to meet her, and bowed himself unto her, and sat down on his throne, and caused a seat to be set for the king's mother; and she sat on his right hand. 20 Then she said , I desire one small petition of thee; I pray thee, say me not nay . And the king said unto her, Ask on , my mother: for I will not say thee nay . 21 And she said , Let Abishag the Shunammite be given to Adonijah thy brother to wife. 22 And king Solomon answered and said unto his mother, And why dost thou ask Abishag the Shunammite for Adonijah? ask for him the kingdom also; for he is mine elder brother; even for him, and for Abiathar the priest, and for Joab the son of Zeruiah. 23 Then king Solomon sware by the LORD, saying , God do so to me, and more also , if Adonijah have not spoken this word against his own life. 24 Now therefore, as the LORD liveth, which hath established me, and set me on the throne of David my father, and who hath made me an house, as he promised , Adonijah shall be put to death this day. 25 And king Solomon sent by the hand of Benaiah the son of Jehoiada; and he fell upon him that he died . 26 And unto Abiathar the priest said the king, Get thee to Anathoth, unto thine own fields; for thou art worthy of death: but I will not at this time put thee to death , because thou barest the ark of the Lord GOD before David my father, and because thou hast been afflicted in all wherein my father was afflicted . 27 So Solomon thrust out Abiathar from being priest unto the LORD; that he might fulfil the word of the LORD, which he spake concerning the house of Eli in Shiloh. 28 Then tidings came to Joab: for Joab had turned after Adonijah, though he turned not after Absalom. And Joab fled unto the tabernacle of the LORD, and caught hold on the horns of the altar. 29 And it was told king Solomon that Joab was fled unto the tabernacle of the LORD; and, behold, he is by the altar. Then Solomon sent Benaiah the son of Jehoiada, saying , Go , fall upon him. 30 And Benaiah came to the tabernacle of the LORD, and said unto him, Thus saith the king, Come forth . And he said , Nay; but I will die here. And Benaiah brought the king word again , saying , Thus said Joab, and thus he answered me. 31 And the king said unto him, Do as he hath said , and fall upon him, and bury him; that thou mayest take away the innocent blood, which Joab shed , from me, and from the house of my father. 32 And the LORD shall return his blood upon his own head, who fell upon two men more righteous and better than he, and slew them with the sword, my father David not knowing thereof, to wit, Abner the son of Ner, captain of the host of Israel, and Amasa the son of Jether, captain of the host of Judah. 33 Their blood shall therefore return upon the head of Joab, and upon the head of his seed for ever: but upon David, and upon his seed, and upon his house, and upon his throne, shall there be peace for ever from the LORD. 34 So Benaiah the son of Jehoiada went up , and fell upon him, and slew him: and he was buried in his own house in the wilderness. 35 And the king put Benaiah the son of Jehoiada in his room over the host: and Zadok the priest did the king put in the room of Abiathar. 36 And the king sent and called for Shimei, and said unto him, Build thee an house in Jerusalem, and dwell there, and go not forth thence any whither. 37 For it shall be, that on the day thou goest out , and passest over the brook Kidron, thou shalt know for certain that thou shalt surely die : thy blood shall be upon thine own head. 38 And Shimei said unto the king, The saying is good: as my lord the king hath said , so will thy servant do . And Shimei dwelt in Jerusalem many days. 39 And it came to pass at the end of three years, that two of the servants of Shimei ran away unto Achish son of Maachah king of Gath. And they told Shimei, saying , Behold, thy servants be in Gath. 40 And Shimei arose , and saddled his ass, and went to Gath to Achish to seek his servants: and Shimei went , and brought his servants from Gath. 41 And it was told Solomon that Shimei had gone from Jerusalem to Gath, and was come again . 42 And the king sent and called for Shimei, and said unto him, Did I not make thee to swear by the LORD, and protested unto thee, saying , Know for a certain , on the day thou goest out , and walkest abroad any whither, that thou shalt surely die ? and thou saidst unto me, The word that I have heard is good. 43 Why then hast thou not kept the oath of the LORD, and the commandment that I have charged thee with? 44 The king said moreover to Shimei, Thou knowest all the wickedness which thine heart is privy to , that thou didst to David my father: therefore the LORD shall return thy wickedness upon thine own head; 45 And king Solomon shall be blessed , and the throne of David shall be established before the LORD for ever. 46 So the king commanded Benaiah the son of Jehoiada; which went out , and fell upon him, that he died . And the kingdom was established in the hand of Solomon. Hosea 5:5-15

5 And the pride of Israel doth testify to his face: therefore shall Israel and Ephraim fall in their iniquity; Judah also shall fall with them. 6 They shall go with their flocks and with their herds to seek the LORD; but they shall not find him; he hath withdrawn himself from them. 7 They have dealt treacherously against the LORD: for they have begotten strange children: now shall a month devour them with their portions. 8 Blow ye the cornet in Gibeah, and the trumpet in Ramah: cry aloud at Bethaven, after thee, O Benjamin. 9 Ephraim shall be desolate in the day of rebuke: among the tribes of Israel have I made known that which shall surely be . 10 The princes of Judah were like them that remove the bound: therefore I will pour out my wrath upon them like water. 11 Ephraim is oppressed and broken in judgment, because he willingly walked after the commandment. 12 Therefore will I be unto Ephraim as a moth, and to the house of Judah as rottenness. 13 When Ephraim saw his sickness, and Judah saw his wound, then went Ephraim to the Assyrian, and sent to king Jareb : yet could he not heal you, nor cure you of your wound. 14 For I will be unto Ephraim as a lion, and as a young lion to the house of Judah: I, even I, will tear and go away ; I will take away , and none shall rescue him. 15 I will go and return to my place, till they acknowledge their offence , and seek my face: in their affliction they will seek me early . The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Fri 01 Jul 2011, 1:12 pm

Daily Bible Reading from BibleStudyTools.com
July 1, 2011 - King James Version
Mark 11:1-14
1 And when they came nigh to Jerusalem, unto Bethphage and Bethany, at the mount of Olives, he sendeth forth two of his disciples, 2 And saith unto them, Go your way into the village over against you: and as soon as ye be entered into it, ye shall find a colt tied , whereon never man sat ; loose him, and bring him. 3 And if any man say unto you, Why do ye this? say ye that the Lord hath need of him; and straightway he will send him hither. 4 And they went their way , and found the colt tied by the door without in a place where two ways met; and they loose him. 5 And certain of them that stood there said unto them, What do ye , loosing the colt? 6 And they said unto them even as Jesus had commanded : and they let them go . 7 And they brought the colt to Jesus, and cast their garments on him; and he sat upon him. 8 And many spread their garments in the way: and others cut down branches off the trees, and strawed them in the way. 9 And they that went before , and they that followed , cried , saying , Hosanna; Blessed is he that cometh in the name of the Lord: 10 Blessed be the kingdom of our father David, that cometh in the name of the Lord: Hosanna in the highest. 11 And Jesus entered into Jerusalem, and into the temple: and when he had looked round about upon all things, and now the eventide was come , he went out unto Bethany with the twelve. 12 And on the morrow, when they were come from Bethany, he was hungry : 13 And seeing a fig tree afar off having leaves, he came , if haply he might find any thing thereon : and when he came to it, he found nothing but leaves; for the time of figs was not yet. 14 And Jesus answered and said unto it, No man eat fruit of thee hereafter for ever. And his disciples heard it. 1 Kings 1:1-53
1 Now king David was old and stricken in years; and they covered him with clothes, but he gat no heat . 2 Wherefore his servants said unto him, Let there be sought for my lord the king a young virgin: and let her stand before the king, and let her cherish him, and let her lie in thy bosom, that my lord the king may get heat . 3 So they sought for a fair damsel throughout all the coasts of Israel, and found Abishag a Shunammite, and brought her to the king. 4 And the damsel was very fair, and cherished the king, and ministered to him: but the king knew her not. 5 Then Adonijah the son of Haggith exalted himself, saying , I will be king : and he prepared him chariots and horsemen, and fifty men to run before him. 6 And his father had not displeased him at any time in saying , Why hast thou done so ? and he also was a very goodly man; and his mother bare him after Absalom. 7 And he conferred with Joab the son of Zeruiah, and with Abiathar the priest: and they following Adonijah helped him. 8 But Zadok the priest, and Benaiah the son of Jehoiada, and Nathan the prophet, and Shimei, and Rei, and the mighty men which belonged to David, were not with Adonijah. 9 And Adonijah slew sheep and oxen and fat cattle by the stone of Zoheleth, which is by Enrogel, and called all his brethren the king's sons, and all the men of Judah the king's servants: 10 But Nathan the prophet, and Benaiah, and the mighty men, and Solomon his brother, he called not. 11 Wherefore Nathan spake unto Bathsheba the mother of Solomon, saying , Hast thou not heard that Adonijah the son of Haggith doth reign , and David our lord knoweth it not? 12 Now therefore come , let me, I pray thee, give thee counsel , that thou mayest save thine own life, and the life of thy son Solomon. 13 Go and get thee in unto king David, and say unto him, Didst not thou, my lord, O king, swear unto thine handmaid, saying , Assuredly Solomon thy son shall reign after me, and he shall sit upon my throne? why then doth Adonijah reign ? 14 Behold, while thou yet talkest there with the king, I also will come in after thee, and confirm thy words. 15 And Bathsheba went in unto the king into the chamber: and the king was very old ; and Abishag the Shunammite ministered unto the king. 16 And Bathsheba bowed , and did obeisance unto the king. And the king said , What wouldest thou? 17 And she said unto him, My lord, thou swarest by the LORD thy God unto thine handmaid, saying, Assuredly Solomon thy son shall reign after me, and he shall sit upon my throne. 18 And now, behold, Adonijah reigneth ; and now, my lord the king, thou knowest it not: 19 And he hath slain oxen and fat cattle and sheep in abundance, and hath called all the sons of the king, and Abiathar the priest, and Joab the captain of the host: but Solomon thy servant hath he not called . 20 And thou, my lord, O king, the eyes of all Israel are upon thee, that thou shouldest tell them who shall sit on the throne of my lord the king after him. 21 Otherwise it shall come to pass, when my lord the king shall sleep with his fathers, that I and my son Solomon shall be counted offenders. 22 And, lo, while she yet talked with the king, Nathan the prophet also came in . 23 And they told the king, saying , Behold Nathan the prophet. And when he was come in before the king, he bowed himself before the king with his face to the ground. 24 And Nathan said , My lord, O king, hast thou said , Adonijah shall reign after me, and he shall sit upon my throne? 25 For he is gone down this day, and hath slain oxen and fat cattle and sheep in abundance, and hath called all the king's sons, and the captains of the host, and Abiathar the priest; and, behold, they eat and drink before him, and say , God save king Adonijah. 26 But me, even me thy servant, and Zadok the priest, and Benaiah the son of Jehoiada, and thy servant Solomon, hath he not called . 27 Is this thing done by my lord the king, and thou hast not shewed it unto thy servant, who should sit on the throne of my lord the king after him? 28 Then king David answered and said , Call me Bathsheba. And she came into the king's presence, and stood before the king. 29 And the king sware , and said , As the LORD liveth, that hath redeemed my soul out of all distress, 30 Even as I sware unto thee by the LORD God of Israel, saying , Assuredly Solomon thy son shall reign after me, and he shall sit upon my throne in my stead; even so will I certainly do this day. 31 Then Bathsheba bowed with her face to the earth, and did reverence to the king, and said , Let my lord king David live for ever. 32 And king David said , Call me Zadok the priest, and Nathan the prophet, and Benaiah the son of Jehoiada. And they came before the king. 33 The king also said unto them, Take with you the servants of your lord, and cause Solomon my son to ride upon mine own mule, and bring him down to Gihon: 34 And let Zadok the priest and Nathan the prophet anoint him there king over Israel: and blow ye with the trumpet, and say , God save king Solomon. 35 Then ye shall come up after him, that he may come and sit upon my throne; for he shall be king in my stead: and I have appointed him to be ruler over Israel and over Judah. 36 And Benaiah the son of Jehoiada answered the king, and said , Amen: the LORD God of my lord the king say so too. 37 As the LORD hath been with my lord the king, even so be he with Solomon, and make his throne greater than the throne of my lord king David. 38 So Zadok the priest, and Nathan the prophet, and Benaiah the son of Jehoiada, and the Cherethites, and the Pelethites, went down , and caused Solomon to ride upon king David's mule, and brought him to Gihon. 39 And Zadok the priest took an horn of oil out of the tabernacle, and anointed Solomon. And they blew the trumpet; and all the people said , God save king Solomon. 40 And all the people came up after him, and the people piped with pipes, and rejoiced with great joy, so that the earth rent with the sound of them. 41 And Adonijah and all the guests that were with him heard it as they had made an end of eating . And when Joab heard the sound of the trumpet, he said , Wherefore is this noise of the city being in an uproar ? 42 And while he yet spake , behold, Jonathan the son of Abiathar the priest came : and Adonijah said unto him, Come in ; for thou art a valiant man , and bringest good tidings . 43 And Jonathan answered and said to Adonijah, Verily our lord king David hath made Solomon king . 44 And the king hath sent with him Zadok the priest, and Nathan the prophet, and Benaiah the son of Jehoiada, and the Cherethites, and the Pelethites, and they have caused him to ride upon the king's mule: 45 And Zadok the priest and Nathan the prophet have anointed him king in Gihon: and they are come up from thence rejoicing, so that the city rang again . This is the noise that ye have heard . 46 And also Solomon sitteth on the throne of the kingdom. 47 And moreover the king's servants came to bless our lord king David, saying , God make the name of Solomon better than thy name, and make his throne greater than thy throne. And the king bowed himself upon the bed. 48 And also thus said the king, Blessed be the LORD God of Israel, which hath given one to sit on my throne this day, mine eyes even seeing it. 49 And all the guests that were with Adonijah were afraid , and rose up , and went every man his way. 50 And Adonijah feared because of Solomon, and arose , and went , and caught hold on the horns of the altar. 51 And it was told Solomon, saying , Behold, Adonijah feareth king Solomon: for, lo, he hath caught hold on the horns of the altar, saying , Let king Solomon swear unto me to day that he will not slay his servant with the sword. 52 And Solomon said , If he will shew himself a worthy man, there shall not an hair of him fall to the earth: but if wickedness shall be found in him, he shall die . 53 So king Solomon sent , and they brought him down from the altar. And he came and bowed himself to king Solomon: and Solomon said unto him, Go to thine house. Hosea 4:11-19
11 Whoredom and wine and new wine take away the heart. 12 My people ask counsel at their stocks, and their staff declareth unto them: for the spirit of whoredoms hath caused them to err , and they have gone a whoring from under their God. 13 They sacrifice upon the tops of the mountains, and burn incense upon the hills, under oaks and poplars and elms, because the shadow thereof is good: therefore your daughters shall commit whoredom , and your spouses shall commit adultery . 14 I will not punish your daughters when they commit whoredom , nor your spouses when they commit adultery : for themselves are separated with whores , and they sacrifice with harlots: therefore the people that doth not understand shall fall . 15 Though thou, Israel, play the harlot , yet let not Judah offend ; and come not ye unto Gilgal, neither go ye up to Bethaven, nor swear , The LORD liveth. 16 For Israel slideth back as a backsliding heifer: now the LORD will feed them as a lamb in a large place. 17 Ephraim is joined to idols: let him alone . 18 Their drink is sour : they have committed whoredom continually : her rulers with shame do love , Give ye. 19 The wind hath bound her up in her wings, and they shall be ashamed because of their sacrifices. Hosea 5:1-4
1 Hear ye this, O priests; and hearken , ye house of Israel; and give ye ear , O house of the king; for judgment is toward you, because ye have been a snare on Mizpah, and a net spread upon Tabor. 2 And the revolters are profound to make slaughter , though I have been a rebuker of them all. 3 I know Ephraim, and Israel is not hid from me: for now, O Ephraim, thou committest whoredom , and Israel is defiled . 4 They will not frame their doings to turn unto their God: for the spirit of whoredoms is in the midst of them, and they have not known the LORD. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/

Daily Bible Reading from BibleStudyTools.com
June 30, 2011 - King James Version
Mark 10:32-52
32 And they were in the way going up to Jerusalem; and Jesus went before them: and they were amazed ; and as they followed , they were afraid . And he took again the twelve, and began to tell them what things should happen unto him, 33 Saying, Behold , we go up to Jerusalem; and the Son of man shall be delivered unto the chief priests, and unto the scribes; and they shall condemn him to death, and shall deliver him to the Gentiles: 34 And they shall mock him, and shall scourge him, and shall spit upon him, and shall kill him: and the third day he shall rise again . 35 And James and John, the sons of Zebedee, come unto him, saying , Master, we would that thou shouldest do for us whatsoever we shall desire . 36 And he said unto them, What would ye that I should do for you? 37 They said unto him, Grant unto us that we may sit , one on thy right hand, and the other on thy left hand, in thy glory. 38 But Jesus said unto them, Ye know not what ye ask : can ye drink of the cup that I drink of ? and be baptized with the baptism that I am baptized with ? 39 And they said unto him, We can . And Jesus said unto them, Ye shall indeed drink of the cup that I drink of ; and with the baptism that I am baptized withal shall ye be baptized : 40 But to sit on my right hand and on my left hand is not mine to give ; but it shall be given to them for whom it is prepared . 41 And when the ten heard it, they began to be much displeased with James and John. 42 But Jesus called them to him, and saith unto them, Ye know that they which are accounted to rule over the Gentiles exercise lordship over them; and their great ones exercise authority upon them. 43 But so shall it not be among you: but whosoever will be great among you, shall be your minister: 44 And whosoever of you will be the chiefest, shall be servant of all. 45 For even the Son of man came not to be ministered unto , but to minister , and to give his life a ransom for many. 46 And they came to Jericho: and as he went out of Jericho with his disciples and a great number of people, blind Bartimaeus, the son of Timaeus, sat by the highway side begging . 47 And when he heard that it was Jesus of Nazareth, he began to cry out , and say , Jesus, thou Son of David, have mercy on me. 48 And many charged him that he should hold his peace : but he cried the more a great deal, Thou Son of David, have mercy on me. 49 And Jesus stood still , and commanded him to be called . And they call the blind man, saying unto him, Be of good comfort , rise ; he calleth thee. 50 And he, casting away his garment, rose , and came to Jesus. 51 And Jesus answered and said unto him, What wilt thou that I should do unto thee ? The blind man said unto him, Lord, that I might receive my sight . 52 And Jesus said unto him, Go thy way ; thy faith hath made thee whole . And immediately he received his sight , and followed Jesus in the way. 2 Samuel 24:1-25
1 And again the anger of the LORD was kindled against Israel, and he moved David against them to say , Go , number Israel and Judah. 2 For the king said to Joab the captain of the host, which was with him, Go now through all the tribes of Israel, from Dan even to Beersheba, and number ye the people, that I may know the number of the people. 3 And Joab said unto the king, Now the LORD thy God add unto the people, how many soever they be, an hundredfold , and that the eyes of my lord the king may see it: but why doth my lord the king delight in this thing? 4 Notwithstanding the king's word prevailed against Joab, and against the captains of the host. And Joab and the captains of the host went out from the presence of the king, to number the people of Israel. 5 And they passed over Jordan, and pitched in Aroer, on the right side of the city that lieth in the midst of the river of Gad, and toward Jazer: 6 Then they came to Gilead, and to the land of Tahtimhodshi; and they came to Danjaan, and about to Zidon, 7 And came to the strong hold of Tyre, and to all the cities of the Hivites, and of the Canaanites: and they went out to the south of Judah, even to Beersheba. 8 So when they had gone through all the land, they came to Jerusalem at the end of nine months and twenty days. 9 And Joab gave up the sum of the number of the people unto the king: and there were in Israel eight hundred thousand valiant men that drew the sword; and the men of Judah were five hundred thousand men. 10 And David's heart smote him after that he had numbered the people. And David said unto the LORD, I have sinned greatly in that I have done : and now, I beseech thee, O LORD, take away the iniquity of thy servant; for I have done very foolishly . 11 For when David was up in the morning, the word of the LORD came unto the prophet Gad, David's seer, saying , 12 Go and say unto David, Thus saith the LORD, I offer thee three things; choose thee one of them, that I may do it unto thee . 13 So Gad came to David, and told him, and said unto him, Shall seven years of famine come unto thee in thy land? or wilt thou flee three months before thine enemies, while they pursue thee? or that there be three days' pestilence in thy land? now advise , and see what answer I shall return to him that sent me. 14 And David said unto Gad, I am in a great strait : let us fall now into the hand of the LORD; for his mercies are great: and let me not fall into the hand of man. 15 So the LORD sent a pestilence upon Israel from the morning even to the time appointed: and there died of the people from Dan even to Beersheba seventy thousand men. 16 And when the angel stretched out his hand upon Jerusalem to destroy it, the LORD repented him of the evil, and said to the angel that destroyed the people, It is enough: stay now thine hand. And the angel of the LORD was by the threshingplace of Araunah the Jebusite. 17 And David spake unto the LORD when he saw the angel that smote the people, and said , Lo, I have sinned , and I have done wickedly : but these sheep, what have they done ? let thine hand, I pray thee, be against me, and against my father's house. 18 And Gad came that day to David, and said unto him, Go up , rear an altar unto the LORD in the threshingfloor of Araunah the Jebusite. 19 And David, according to the saying of Gad, went up as the LORD commanded . 20 And Araunah looked , and saw the king and his servants coming on toward him: and Araunah went out , and bowed himself before the king on his face upon the ground. 21 And Araunah said , Wherefore is my lord the king come to his servant? And David said , To buy the threshingfloor of thee, to build an altar unto the LORD, that the plague may be stayed from the people. 22 And Araunah said unto David, Let my lord the king take and offer up what seemeth good unto him: behold , here be oxen for burnt sacrifice, and threshing instruments and other instruments of the oxen for wood. 23 All these things did Araunah, as a king, give unto the king. And Araunah said unto the king, The LORD thy God accept thee. 24 And the king said unto Araunah, Nay; but I will surely buy it of thee at a price: neither will I offer burnt offerings unto the LORD my God of that which doth cost me nothing. So David bought the threshingfloor and the oxen for fifty shekels of silver. 25 And David built there an altar unto the LORD, and offered burnt offerings and peace offerings. So the LORD was intreated for the land, and the plague was stayed from Israel. Hosea 4:1-11
1 Hear the word of the LORD, ye children of Israel: for the LORD hath a controversy with the inhabitants of the land, because there is no truth, nor mercy, nor knowledge of God in the land. 2 By swearing , and lying , and killing , and stealing , and committing adultery , they break out , and blood toucheth blood. 3 Therefore shall the land mourn , and every one that dwelleth therein shall languish , with the beasts of the field, and with the fowls of heaven; yea, the fishes of the sea also shall be taken away . 4 Yet let no man strive , nor reprove another: for thy people are as they that strive with the priest. 5 Therefore shalt thou fall in the day, and the prophet also shall fall with thee in the night, and I will destroy thy mother. 6 My people are destroyed for lack of knowledge: because thou hast rejected knowledge, I will also reject thee, that thou shalt be no priest to me: seeing thou hast forgotten the law of thy God, I will also forget thy children. 7 As they were increased, so they sinned against me: therefore will I change their glory into shame. 8 They eat up the sin of my people, and they set their heart on their iniquity. 9 And there shall be, like people, like priest: and I will punish them for their ways, and reward them their doings. 10 For they shall eat , and not have enough : they shall commit whoredom , and shall not increase : because they have left off to take heed to the LORD. 11 Whoredom and wine and new wine take away the heart. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Gcclynctlwldcmthdkqpjdsjcndmgqqmwrcjyyhywgytkcc_jsnvrbsjvvnq

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Wed 29 Jun 2011, 11:33 pm

Daily Bible Reading from BibleStudyTools.com
June 29, 2011 - King James Version
Mark 10:1-31
1 And he arose from thence, and cometh into the coasts of Judaea by the farther side of Jordan: and the people resort unto him again; and, as he was wont , he taught them again. 2 And the Pharisees came to him , and asked him, Is it lawful for a man to put away his wife? tempting him. 3 And he answered and said unto them, What did Moses command you? 4 And they said , Moses suffered to write a bill of divorcement, and to put her away . 5 And Jesus answered and said unto them, For the hardness of your heart he wrote you this precept. 6 But from the beginning of the creation God made them male and female. 7 For this cause shall a man leave his father and mother, and cleave to his wife; 8 And they twain shall be one flesh: so then they are no more twain, but one flesh. 9 What therefore God hath joined together , let not man put asunder . 10 And in the house his disciples asked him again of the same matter. 11 And he saith unto them, Whosoever shall put away his wife, and marry another, committeth adultery against her. 12 And if a woman shall put away her husband, and be married to another, she committeth adultery . 13 And they brought young children to him, that he should touch them: and his disciples rebuked those that brought them. 14 But when Jesus saw it, he was much displeased , and said unto them, Suffer the little children to come unto me, and forbid them not: for of such is the kingdom of God. 15 Verily I say unto you, Whosoever shall not receive the kingdom of God as a little child, he shall not enter therein . 16 And he took them up in his arms , put his hands upon them, and blessed them. 17 And when he was gone forth into the way , there came one running , and kneeled to him, and asked him, Good Master, what shall I do that I may inherit eternal life? 18 And Jesus said unto him, Why callest thou me good? there is none good but one, that is, God. 19 Thou knowest the commandments, Do not commit adultery , Do not kill , Do not steal , Do not bear false witness , Defraud not, Honour thy father and mother. 20 And he answered and said unto him, Master, all these have I observed from my youth. 21 Then Jesus beholding him loved him, and said unto him, One thing thou lackest : go thy way , sell whatsoever thou hast , and give to the poor, and thou shalt have treasure in heaven: and come , take up the cross, and follow me. 22 And he was sad at that saying, and went away grieved : for he had great possessions. 23 And Jesus looked round about , and saith unto his disciples, How hardly shall they that have riches enter into the kingdom of God! 24 And the disciples were astonished at his words. But Jesus answereth again, and saith unto them, Children, how hard is it for them that trust in riches to enter into the kingdom of God! 25 It is easier for a camel to go through the eye of a needle, than for a rich man to enter into the kingdom of God. 26 And they were astonished out of measure, saying among themselves , Who then can be saved ? 27 And Jesus looking upon them saith , With men it is impossible, but not with God: for with God all things are possible. 28 Then Peter began to say unto him, Lo , we have left all, and have followed thee. 29 And Jesus answered and said , Verily I say unto you, There is no man that hath left house, or brethren, or sisters, or father, or mother, or wife, or children, or lands, for my sake, and the gospel's, 30 But he shall receive an hundredfold now in this time, houses, and brethren, and sisters, and mothers, and children, and lands, with persecutions; and in the world to come eternal life. 31 But many that are first shall be last; and the last first. 2 Samuel 23:1-39
1 Now these be the last words of David. David the son of Jesse said , and the man who was raised up on high, the anointed of the God of Jacob, and the sweet psalmist of Israel, said , 2 The Spirit of the LORD spake by me, and his word was in my tongue. 3 The God of Israel said , the Rock of Israel spake to me, He that ruleth over men must be just, ruling in the fear of God. 4 And he shall be as the light of the morning, when the sun riseth , even a morning without clouds; as the tender grass springing out of the earth by clear shining after rain. 5 Although my house be not so with God; yet he hath made with me an everlasting covenant, ordered in all things, and sure : for this is all my salvation, and all my desire, although he make it not to grow . 6 But the sons of Belial shall be all of them as thorns thrust away , because they cannot be taken with hands: 7 But the man that shall touch them must be fenced with iron and the staff of a spear; and they shall be utterly burned with fire in the same place . 8 These be the names of the mighty men whom David had: The Tachmonite that sat in the seat , chief among the captains; the same was Adino the Eznite: he lift up his spear against eight hundred, whom he slew at one time. 9 And after him was Eleazar the son of Dodo the Ahohite, one of the three mighty men with David, when they defied the Philistines that were there gathered together to battle, and the men of Israel were gone away : 10 He arose , and smote the Philistines until his hand was weary , and his hand clave unto the sword: and the LORD wrought a great victory that day; and the people returned after him only to spoil . 11 And after him was Shammah the son of Agee the Hararite. And the Philistines were gathered together into a troop, where was a piece of ground full of lentiles: and the people fled from the Philistines. 12 But he stood in the midst of the ground, and defended it, and slew the Philistines: and the LORD wrought a great victory. 13 And three of the thirty chief went down , and came to David in the harvest time unto the cave of Adullam: and the troop of the Philistines pitched in the valley of Rephaim. 14 And David was then in an hold, and the garrison of the Philistines was then in Bethlehem. 15 And David longed , and said , Oh that one would give me drink of the water of the well of Bethlehem, which is by the gate! 16 And the three mighty men brake through the host of the Philistines, and drew water out of the well of Bethlehem, that was by the gate, and took it, and brought it to David: nevertheless he would not drink thereof, but poured it out unto the LORD. 17 And he said , Be it far from me, O LORD, that I should do this: is not this the blood of the men that went in jeopardy of their lives? therefore he would not drink it. These things did these three mighty men. 18 And Abishai, the brother of Joab, the son of Zeruiah, was chief among three. And he lifted up his spear against three hundred, and slew them, and had the name among three. 19 Was he not most honourable of three? therefore he was their captain: howbeit he attained not unto the first three. 20 And Benaiah the son of Jehoiada, the son of a valiant man , of Kabzeel, who had done many acts, he slew two lionlike men of Moab: he went down also and slew a lion in the midst of a pit in time of snow: 21 And he slew an Egyptian, a goodly man: and the Egyptian had a spear in his hand; but he went down to him with a staff, and plucked the spear out of the Egyptian's hand, and slew him with his own spear. 22 These things did Benaiah the son of Jehoiada, and had the name among three mighty men. 23 He was more honourable than the thirty, but he attained not to the first three. And David set him over his guard. 24 Asahel the brother of Joab was one of the thirty; Elhanan the son of Dodo of Bethlehem, 25 Shammah the Harodite, Elika the Harodite, 26 Helez the Paltite, Ira the son of Ikkesh the Tekoite, 27 Abiezer the Anethothite, Mebunnai the Hushathite, 28 Zalmon the Ahohite, Maharai the Netophathite, 29 Heleb the son of Baanah, a Netophathite, Ittai the son of Ribai out of Gibeah of the children of Benjamin, 30 Benaiah the Pirathonite, Hiddai of the brooks of Gaash, 31 Abialbon the Arbathite, Azmaveth the Barhumite, 32 Eliahba the Shaalbonite, of the sons of Jashen, Jonathan, 33 Shammah the Hararite, Ahiam the son of Sharar the Hararite, 34 Eliphelet the son of Ahasbai, the son of the Maachathite, Eliam the son of Ahithophel the Gilonite, 35 Hezrai the Carmelite, Paarai the Arbite, 36 Igal the son of Nathan of Zobah, Bani the Gadite, 37 Zelek the Ammonite, Naharai the Beerothite, armourbearer to Joab the son of Zeruiah, 38 Ira an Ithrite, Gareb an Ithrite, 39 Uriah the Hittite: thirty and seven in all. Hosea 3:1-5
1 Then said the LORD unto me, Go yet, love a woman beloved of her friend, yet an adulteress , according to the love of the LORD toward the children of Israel, who look to other gods, and love flagons of wine. 2 So I bought her to me for fifteen pieces of silver, and for an homer of barley, and an half homer of barley: 3 And I said unto her, Thou shalt abide for me many days; thou shalt not play the harlot , and thou shalt not be for another man: so will I also be for thee. 4 For the children of Israel shall abide many days without a king, and without a prince, and without a sacrifice, and without an image, and without an ephod, and without teraphim: 5 Afterward shall the children of Israel return , and seek the LORD their God, and David their king; and shall fear the LORD and his goodness in the latter days. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Vkyjvmfgjrjnfygtnkbzqndqfmnypbbyrhfqvvtvrpfvjpp_bdzglpdfggzc

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Tue 28 Jun 2011, 1:45 pm

Daily Bible Reading from BibleStudyTools.com
June 28, 2011 - King James Version
Mark 9:2-50
2 And after six days Jesus taketh with him Peter, and James, and John, and leadeth them up into an high mountain apart by themselves: and he was transfigured before them. 3 And his raiment became shining , exceeding white as snow; so as no fuller on earth can white them. 4 And there appeared unto them Elias with Moses: and they were talking with Jesus. 5 And Peter answered and said to Jesus, Master, it is good for us to be here: and let us make three tabernacles; one for thee, and one for Moses, and one for Elias. 6 For he wist not what to say ; for they were sore afraid. 7 And there was a cloud that overshadowed them: and a voice came out of the cloud, saying , This is my beloved Son: hear him. 8 And suddenly, when they had looked round about , they saw no man any more, save Jesus only with themselves. 9 And as they came down from the mountain, he charged them that they should tell no man what things they had seen , till the Son of man were risen from the dead. 10 And they kept that saying with themselves, questioning one with another what the rising from the dead should mean . 11 And they asked him, saying , Why say the scribes that Elias must first come ? 12 And he answered and told them, Elias verily cometh first, and restoreth all things; and how it is written of the Son of man, that he must suffer many things, and be set at nought . 13 But I say unto you, That Elias is indeed come , and they have done unto him whatsoever they listed , as it is written of him. 14 And when he came to his disciples, he saw a great multitude about them, and the scribes questioning with them. 15 And straightway all the people, when they beheld him, were greatly amazed , and running to him saluted him. 16 And he asked the scribes, What question ye with them ? 17 And one of the multitude answered and said , Master, I have brought unto thee my son, which hath a dumb spirit; 18 And wheresoever he taketh him, he teareth him: and he foameth , and gnasheth with his teeth, and pineth away : and I spake to thy disciples that they should cast him out ; and they could not. 19 He answereth him, and saith , O faithless generation, how long shall I be with you? how long shall I suffer you? bring him unto me. 20 And they brought him unto him: and when he saw him, straightway the spirit tare him; and he fell on the ground, and wallowed foaming . 21 And he asked his father, How long is it ago since this came unto him? And he said , Of a child. 22 And ofttimes it hath cast him into the fire, and into the waters, to destroy him: but if thou canst do any thing, have compassion on us, and help us. 23 Jesus said unto him, If thou canst believe , all things are possible to him that believeth . 24 And straightway the father of the child cried out , and said with tears, Lord, I believe ; help thou mine unbelief. 25 When Jesus saw that the people came running together , he rebuked the foul spirit, saying unto him, Thou dumb and deaf spirit, I charge thee, come out of him, and enter no more into him. 26 And the spirit cried , and rent him sore, and came out of him : and he was as one dead; insomuch that many said , He is dead . 27 But Jesus took him by the hand, and lifted him up ; and he arose . 28 And when he was come into the house, his disciples asked him privately , Why could not we cast him out ? 29 And he said unto them, This kind can come forth by nothing, but by prayer and fasting. 30 And they departed thence, and passed through Galilee; and he would not that any man should know it. 31 For he taught his disciples, and said unto them , The Son of man is delivered into the hands of men, and they shall kill him; and after that he is killed , he shall rise the third day. 32 But they understood not that saying, and were afraid to ask him. 33 And he came to Capernaum: and being in the house he asked them, What was it that ye disputed among yourselves by the way? 34 But they held their peace : for by the way they had disputed among themselves, who should be the greatest. 35 And he sat down , and called the twelve, and saith unto them, If any man desire to be first, the same shall be last of all, and servant of all. 36 And he took a child, and set him in the midst of them: and when he had taken him in his arms , he said unto them, 37 Whosoever shall receive one of such children in my name, receiveth me: and whosoever shall receive me, receiveth not me, but him that sent me. 38 And John answered him, saying , Master, we saw one casting out devils in thy name, and he followeth not us: and we forbad him, because he followeth not us. 39 But Jesus said , Forbid him not: for there is no man which shall do a miracle in my name, that can lightly speak evil of me. 40 For he that is not against us is on our part. 41 For whosoever shall give you a cup of water to drink in my name, because ye belong to Christ, verily I say unto you, he shall not lose his reward. 42 And whosoever shall offend one of these little ones that believe in me, it is better for him that a millstone were hanged about his neck, and he were cast into the sea. 43 And if thy hand offend thee, cut it off : it is better for thee to enter into life maimed, than having two hands to go into hell, into the fire that never shall be quenched: 44 Where their worm dieth not, and the fire is not quenched . 45 And if thy foot offend thee, cut it off : it is better for thee to enter halt into life, than having two feet to be cast into hell, into the fire that never shall be quenched: 46 Where their worm dieth not, and the fire is not quenched . 47 And if thine eye offend thee, pluck it out : it is better for thee to enter into the kingdom of God with one eye, than having two eyes to be cast into hell fire: 48 Where their worm dieth not, and the fire is not quenched . 49 For every one shall be salted with fire, and every sacrifice shall be salted with salt. 50 Salt is good: but if the salt have lost his saltness, wherewith will ye season it? Have salt in yourselves, and have peace one with another. 2 Samuel 22:1-51
1 And David spake unto the LORD the words of this song in the day that the LORD had delivered him out of the hand of all his enemies , and out of the hand of Saul: 2 And he said , The LORD is my rock, and my fortress, and my deliverer ; 3 The God of my rock; in him will I trust : he is my shield, and the horn of my salvation, my high tower, and my refuge, my saviour ; thou savest me from violence. 4 I will call on the LORD, who is worthy to be praised : so shall I be saved from mine enemies . 5 When the waves of death compassed me, the floods of ungodly men made me afraid ; 6 The sorrows of hell compassed me about ; the snares of death prevented me; 7 In my distress I called upon the LORD, and cried to my God: and he did hear my voice out of his temple, and my cry did enter into his ears. 8 Then the earth shook and trembled ; the foundations of heaven moved and shook , because he was wroth . 9 There went up a smoke out of his nostrils, and fire out of his mouth devoured : coals were kindled by it. 10 He bowed the heavens also, and came down ; and darkness was under his feet. 11 And he rode upon a cherub, and did fly : and he was seen upon the wings of the wind. 12 And he made darkness pavilions round about him, dark waters, and thick clouds of the skies. 13 Through the brightness before him were coals of fire kindled . 14 The LORD thundered from heaven, and the most High uttered his voice. 15 And he sent out arrows, and scattered them; lightning, and discomfited them. 16 And the channels of the sea appeared , the foundations of the world were discovered , at the rebuking of the LORD, at the blast of the breath of his nostrils. 17 He sent from above, he took me; he drew me out of many waters; 18 He delivered me from my strong enemy , and from them that hated me: for they were too strong for me. 19 They prevented me in the day of my calamity: but the LORD was my stay. 20 He brought me forth also into a large place: he delivered me, because he delighted in me. 21 The LORD rewarded me according to my righteousness: according to the cleanness of my hands hath he recompensed me. 22 For I have kept the ways of the LORD, and have not wickedly departed from my God. 23 For all his judgments were before me: and as for his statutes, I did not depart from them. 24 I was also upright before him, and have kept myself from mine iniquity. 25 Therefore the LORD hath recompensed me according to my righteousness; according to my cleanness in his eye sight . 26 With the merciful thou wilt shew thyself merciful , and with the upright man thou wilt shew thyself upright . 27 With the pure thou wilt shew thyself pure ; and with the froward thou wilt shew thyself unsavoury . 28 And the afflicted people thou wilt save : but thine eyes are upon the haughty , that thou mayest bring them down . 29 For thou art my lamp, O LORD: and the LORD will lighten my darkness. 30 For by thee I have run through a troop: by my God have I leaped over a wall. 31 As for God, his way is perfect; the word of the LORD is tried : he is a buckler to all them that trust in him. 32 For who is God, save the LORD? and who is a rock, save our God? 33 God is my strength and power: and he maketh my way perfect. 34 He maketh my feet like hinds' feet: and setteth me upon my high places. 35 He teacheth my hands to war; so that a bow of steel is broken by mine arms. 36 Thou hast also given me the shield of thy salvation: and thy gentleness hath made me great . 37 Thou hast enlarged my steps under me; so that my feet did not slip . 38 I have pursued mine enemies , and destroyed them; and turned not again until I had consumed them. 39 And I have consumed them, and wounded them, that they could not arise : yea, they are fallen under my feet. 40 For thou hast girded me with strength to battle: them that rose up against me hast thou subdued under me. 41 Thou hast also given me the necks of mine enemies , that I might destroy them that hate me. 42 They looked , but there was none to save ; even unto the LORD, but he answered them not. 43 Then did I beat them as small as the dust of the earth, I did stamp them as the mire of the street, and did spread them abroad . 44 Thou also hast delivered me from the strivings of my people, thou hast kept me to be head of the heathen: a people which I knew not shall serve me. 45 Strangers shall submit themselves unto me: as soon as they hear , they shall be obedient unto me. 46 Strangers shall fade away , and they shall be afraid out of their close places. 47 The LORD liveth; and blessed be my rock; and exalted be the God of the rock of my salvation. 48 It is God that avengeth me, and that bringeth down the people under me, 49 And that bringeth me forth from mine enemies : thou also hast lifted me up on high above them that rose up against me: thou hast delivered me from the violent man. 50 Therefore I will give thanks unto thee, O LORD, among the heathen, and I will sing praises unto thy name. 51 He is the tower of salvation for his king: and sheweth mercy to his anointed, unto David, and to his seed for evermore. Hosea 2:2-23
2 Plead with your mother, plead : for she is not my wife, neither am I her husband: let her therefore put away her whoredoms out of her sight, and her adulteries from between her breasts; 3 Lest I strip her naked, and set her as in the day that she was born , and make her as a wilderness, and set her like a dry land, and slay her with thirst. 4 And I will not have mercy upon her children; for they be the children of whoredoms. 5 For their mother hath played the harlot : she that conceived them hath done shamefully : for she said , I will go after my lovers , that give me my bread and my water, my wool and my flax, mine oil and my drink. 6 Therefore, behold, I will hedge up thy way with thorns, and make a wall, that she shall not find her paths. 7 And she shall follow after her lovers , but she shall not overtake them; and she shall seek them, but shall not find them: then shall she say , I will go and return to my first husband; for then was it better with me than now. 8 For she did not know that I gave her corn, and wine, and oil, and multiplied her silver and gold, which they prepared for Baal. 9 Therefore will I return , and take away my corn in the time thereof, and my wine in the season thereof, and will recover my wool and my flax given to cover her nakedness. 10 And now will I discover her lewdness in the sight of her lovers , and none shall deliver her out of mine hand. 11 I will also cause all her mirth to cease , her feast days, her new moons, and her sabbaths, and all her solemn feasts. 12 And I will destroy her vines and her fig trees, whereof she hath said , These are my rewards that my lovers have given me: and I will make them a forest, and the beasts of the field shall eat them. 13 And I will visit upon her the days of Baalim, wherein she burned incense to them, and she decked herself with her earrings and her jewels, and she went after her lovers , and forgat me, saith the LORD. 14 Therefore, behold, I will allure her, and bring her into the wilderness, and speak comfortably unto her. 15 And I will give her her vineyards from thence, and the valley of Achor for a door of hope: and she shall sing there, as in the days of her youth, and as in the day when she came up out of the land of Egypt. 16 And it shall be at that day, saith the LORD, that thou shalt call me Ishi; and shalt call me no more Baali. 17 For I will take away the names of Baalim out of her mouth, and they shall no more be remembered by their name. 18 And in that day will I make a covenant for them with the beasts of the field, and with the fowls of heaven, and with the creeping things of the ground: and I will break the bow and the sword and the battle out of the earth, and will make them to lie down safely. 19 And I will betroth thee unto me for ever; yea, I will betroth thee unto me in righteousness, and in judgment, and in lovingkindness, and in mercies. 20 I will even betroth thee unto me in faithfulness: and thou shalt know the LORD. 21 And it shall come to pass in that day, I will hear , saith the LORD, I will hear the heavens, and they shall hear the earth; 22 And the earth shall hear the corn, and the wine, and the oil; and they shall hear Jezreel. 23 And I will sow her unto me in the earth; and I will have mercy upon her that had not obtained mercy ; and I will say to them which were not my people, Thou art my people; and they shall say , Thou art my God. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Xhsjvsdbjgjtdcbmtplqntkndstchllcgrdnvvmvgvcsscp_igcmhygvmmcn Daily Bible Reading from BibleStudyTools.com
June 27, 2011 - King James Version
Mark 8:22-38

22 And he cometh to Bethsaida; and they bring a blind man unto him, and besought him to touch him. 23 And he took the blind man by the hand, and led him out of the town; and when he had spit on his eyes, and put his hands upon him, he asked him if he saw ought. 24 And he looked up , and said , I see men as trees, walking . 25 After that he put his hands again upon his eyes, and made him look up : and he was restored , and saw every man clearly. 26 And he sent him away to his house, saying , Neither go into the town, nor tell it to any in the town. 27 And Jesus went out , and his disciples, into the towns of Caesarea Philippi: and by the way he asked his disciples, saying unto them, Whom do men say that I am ? 28 And they answered , John the Baptist: but some say, Elias; and others, One of the prophets. 29 And he saith unto them, But whom say ye that I am ? And Peter answereth and saith unto him, Thou art the Christ. 30 And he charged them that they should tell no man of him. 31 And he began to teach them, that the Son of man must suffer many things, and be rejected of the elders, and of the chief priests, and scribes, and be killed , and after three days rise again . 32 And he spake that saying openly. And Peter took him, and began to rebuke him. 33 But when he had turned about and looked on his disciples, he rebuked Peter, saying , Get thee behind me, Satan: for thou savourest not the things that be of God, but the things that be of men. 34 And when he had called the people unto him with his disciples also, he said unto them, Whosoever will come after me, let him deny himself, and take up his cross, and follow me. 35 For whosoever will save his life shall lose it; but whosoever shall lose his life for my sake and the gospel's, the same shall save it. 36 For what shall it profit a man, if he shall gain the whole world, and lose his own soul? 37 Or what shall a man give in exchange for his soul? 38 Whosoever therefore shall be ashamed of me and of my words in this adulterous and sinful generation; of him also shall the Son of man be ashamed , when he cometh in the glory of his Father with the holy angels. Mark 9:1

1 And he said unto them, Verily I say unto you, That there be some of them that stand here, which shall not taste of death, till they have seen the kingdom of God come with power. 2 Samuel 20:1-26

1 And there happened to be there a man of Belial, whose name was Sheba, the son of Bichri, a Benjamite: and he blew a trumpet, and said , We have no part in David, neither have we inheritance in the son of Jesse: every man to his tents, O Israel. 2 So every man of Israel went up from after David, and followed Sheba the son of Bichri: but the men of Judah clave unto their king, from Jordan even to Jerusalem. 3 And David came to his house at Jerusalem; and the king took the ten women his concubines, whom he had left to keep the house, and put them in ward, and fed them, but went not in unto them. So they were shut up unto the day of their death , living in widowhood. 4 Then said the king to Amasa, Assemble me the men of Judah within three days, and be thou here present . 5 So Amasa went to assemble the men of Judah: but he tarried longer than the set time which he had appointed him. 6 And David said to Abishai, Now shall Sheba the son of Bichri do us more harm than did Absalom: take thou thy lord's servants, and pursue after him, lest he get him fenced cities, and escape us. 7 And there went out after him Joab's men, and the Cherethites, and the Pelethites, and all the mighty men: and they went out of Jerusalem, to pursue after Sheba the son of Bichri. 8 When they were at the great stone which is in Gibeon, Amasa went before them. And Joab's garment that he had put on was girded unto him, and upon it a girdle with a sword fastened upon his loins in the sheath thereof; and as he went forth it fell out . 9 And Joab said to Amasa, Art thou in health, my brother? And Joab took Amasa by the beard with the right hand to kiss him. 10 But Amasa took no heed to the sword that was in Joab's hand: so he smote him therewith in the fifth rib, and shed out his bowels to the ground, and struck him not again ; and he died . So Joab and Abishai his brother pursued after Sheba the son of Bichri. 11 And one of Joab's men stood by him, and said , He that favoureth Joab, and he that is for David, let him go after Joab. 12 And Amasa wallowed in blood in the midst of the highway. And when the man saw that all the people stood still , he removed Amasa out of the highway into the field, and cast a cloth upon him, when he saw that every one that came by him stood still . 13 When he was removed out of the highway, all the people went on after Joab, to pursue after Sheba the son of Bichri. 14 And he went through all the tribes of Israel unto Abel, and to Bethmaachah, and all the Berites: and they were gathered together , and went also after him. 15 And they came and besieged him in Abel of Bethmaachah, and they cast up a bank against the city, and it stood in the trench: and all the people that were with Joab battered the wall, to throw it down . 16 Then cried a wise woman out of the city, Hear , hear ; say , I pray you, unto Joab, Come near hither, that I may speak with thee. 17 And when he was come near unto her, the woman said , Art thou Joab? And he answered , I am he. Then she said unto him, Hear the words of thine handmaid. And he answered , I do hear . 18 Then she spake , saying , They were wont to speak in old time, saying , They shall surely ask counsel at Abel: and so they ended the matter. 19 I am one of them that are peaceable and faithful in Israel: thou seekest to destroy a city and a mother in Israel: why wilt thou swallow up the inheritance of the LORD? 20 And Joab answered and said , Far be it, far be it from me, that I should swallow up or destroy . 21 The matter is not so: but a man of mount Ephraim, Sheba the son of Bichri by name, hath lifted up his hand against the king, even against David: deliver him only, and I will depart from the city. And the woman said unto Joab, Behold, his head shall be thrown to thee over the wall. 22 Then the woman went unto all the people in her wisdom. And they cut off the head of Sheba the son of Bichri, and cast it out to Joab. And he blew a trumpet, and they retired from the city, every man to his tent. And Joab returned to Jerusalem unto the king. 23 Now Joab was over all the host of Israel: and Benaiah the son of Jehoiada was over the Cherethites and over the Pelethites: 24 And Adoram was over the tribute: and Jehoshaphat the son of Ahilud was recorder : 25 And Sheva was scribe : and Zadok and Abiathar were the priests: 26 And Ira also the Jairite was a chief ruler about David. 2 Samuel 21:1-22

1 Then there was a famine in the days of David three years, year after year; and David enquired of the LORD. And the LORD answered , It is for Saul, and for his bloody house, because he slew the Gibeonites. 2 And the king called the Gibeonites, and said unto them; (now the Gibeonites were not of the children of Israel, but of the remnant of the Amorites; and the children of Israel had sworn unto them: and Saul sought to slay them in his zeal to the children of Israel and Judah.) 3 Wherefore David said unto the Gibeonites, What shall I do for you? and wherewith shall I make the atonement , that ye may bless the inheritance of the LORD? 4 And the Gibeonites said unto him, We will have no silver nor gold of Saul, nor of his house; neither for us shalt thou kill any man in Israel. And he said , What ye shall say , that will I do for you. 5 And they answered the king, The man that consumed us, and that devised against us that we should be destroyed from remaining in any of the coasts of Israel, 6 Let seven men of his sons be delivered unto us, and we will hang them up unto the LORD in Gibeah of Saul, whom the LORD did choose. And the king said , I will give them. 7 But the king spared Mephibosheth, the son of Jonathan the son of Saul, because of the LORD'S oath that was between them, between David and Jonathan the son of Saul. 8 But the king took the two sons of Rizpah the daughter of Aiah, whom she bare unto Saul, Armoni and Mephibosheth; and the five sons of Michal the daughter of Saul, whom she brought up for Adriel the son of Barzillai the Meholathite: 9 And he delivered them into the hands of the Gibeonites, and they hanged them in the hill before the LORD: and they fell all seven together, and were put to death in the days of harvest, in the first days, in the beginning of barley harvest. 10 And Rizpah the daughter of Aiah took sackcloth, and spread it for her upon the rock, from the beginning of harvest until water dropped upon them out of heaven, and suffered neither the birds of the air to rest on them by day, nor the beasts of the field by night. 11 And it was told David what Rizpah the daughter of Aiah, the concubine of Saul, had done . 12 And David went and took the bones of Saul and the bones of Jonathan his son from the men of Jabeshgilead , which had stolen them from the street of Bethshan, where the Philistines had hanged them, when the Philistines had slain Saul in Gilboa: 13 And he brought up from thence the bones of Saul and the bones of Jonathan his son; and they gathered the bones of them that were hanged . 14 And the bones of Saul and Jonathan his son buried they in the country of Benjamin in Zelah, in the sepulchre of Kish his father: and they performed all that the king commanded . And after that God was intreated for the land. 15 Moreover the Philistines had yet war again with Israel; and David went down , and his servants with him, and fought against the Philistines: and David waxed faint . 16 And Ishbibenob, which was of the sons of the giant, the weight of whose spear weighed three hundred shekels of brass in weight, he being girded with a new sword, thought to have slain David. 17 But Abishai the son of Zeruiah succoured him, and smote the Philistine, and killed him. Then the men of David sware unto him, saying , Thou shalt go no more out with us to battle, that thou quench not the light of Israel. 18 And it came to pass after this, that there was again a battle with the Philistines at Gob: then Sibbechai the Hushathite slew Saph, which was of the sons of the giant. 19 And there was again a battle in Gob with the Philistines, where Elhanan the son of Jaareoregim, a Bethlehemite, slew the brother of Goliath the Gittite, the staff of whose spear was like a weaver's beam. 20 And there was yet a battle in Gath, where was a man of great stature , that had on every hand six fingers, and on every foot six toes, four and twenty in number; and he also was born to the giant. 21 And when he defied Israel, Jonathan the son of Shimea the brother of David slew him. 22 These four were born to the giant in Gath, and fell by the hand of David, and by the hand of his servants. Hosea 1:1-11

1 The word of the LORD that came unto Hosea, the son of Beeri, in the days of Uzziah, Jotham, Ahaz, and Hezekiah, kings of Judah, and in the days of Jeroboam the son of Joash, king of Israel. 2 The beginning of the word of the LORD by Hosea. And the LORD said to Hosea, Go , take unto thee a wife of whoredoms and children of whoredoms: for the land hath committed great whoredom , departing from the LORD. 3 So he went and took Gomer the daughter of Diblaim; which conceived , and bare him a son. 4 And the LORD said unto him, Call his name Jezreel; for yet a little while, and I will avenge the blood of Jezreel upon the house of Jehu, and will cause to cease the kingdom of the house of Israel. 5 And it shall come to pass at that day, that I will break the bow of Israel in the valley of Jezreel. 6 And she conceived again , and bare a daughter. And God said unto him, Call her name Loruhamah : for I will no more have mercy upon the house of Israel; but I will utterly take them away . 7 But I will have mercy upon the house of Judah, and will save them by the LORD their God, and will not save them by bow, nor by sword, nor by battle, by horses, nor by horsemen. 8 Now when she had weaned Loruhamah , she conceived , and bare a son. 9 Then said God, Call his name Loammi: for ye are not my people, and I will not be your God. 10 Yet the number of the children of Israel shall be as the sand of the sea, which cannot be measured nor numbered ; and it shall come to pass, that in the place where it was said unto them, Ye are not my people, there it shall be said unto them, Ye are the sons of the living God. 11 Then shall the children of Judah and the children of Israel be gathered together, and appoint themselves one head, and they shall come up out of the land: for great shall be the day of Jezreel. Hosea 2:1

1 Say ye unto your brethren, Ammi; and to your sisters, Ruhamah . The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Dtddpstmdgdftjmnfrkwlfzltsfjhkkjgctlppnpgpscmdh_qndgwmnsggdp

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Sun 26 Jun 2011, 9:26 pm

Daily Bible Reading from BibleStudyTools.com
June 26, 2011 - King James Version
Mark 8:1-21
1 In those days the multitude being very great, and having nothing to eat , Jesus called his disciples unto him, and saith unto them, 2 I have compassion on the multitude, because they have now been with me three days, and have nothing to eat : 3 And if I send them away fasting to their own houses, they will faint by the way: for divers of them came from far. 4 And his disciples answered him, From whence can a man satisfy these men with bread here in the wilderness? 5 And he asked them, How many loaves have ye ? And they said , Seven. 6 And he commanded the people to sit down on the ground: and he took the seven loaves, and gave thanks , and brake , and gave to his disciples to set before them; and they did set them before the people. 7 And they had a few small fishes: and he blessed , and commanded to set them also before them. 8 So they did eat , and were filled : and they took up of the broken meat that was left seven baskets. 9 And they that had eaten were about four thousand: and he sent them away . 10 And straightway he entered into a ship with his disciples, and came into the parts of Dalmanutha. 11 And the Pharisees came forth , and began to question with him, seeking of him a sign from heaven, tempting him. 12 And he sighed deeply in his spirit, and saith , Why doth this generation seek after a sign? verily I say unto you, There shall no sign be given unto this generation. 13 And he left them, and entering into the ship again departed to the other side. 14 Now the disciples had forgotten to take bread, neither had they in the ship with them more than one loaf. 15 And he charged them, saying , Take heed , beware of the leaven of the Pharisees, and of the leaven of Herod. 16 And they reasoned among themselves, saying , It is because we have no bread. 17 And when Jesus knew it, he saith unto them, Why reason ye , because ye have no bread? perceive ye not yet, neither understand ? have ye your heart yet hardened ? 18 Having eyes, see ye not? and having ears, hear ye not? and do ye not remember ? 19 When I brake the five loaves among five thousand, how many baskets full of fragments took ye up ? They say unto him, Twelve. 20 And when the seven among four thousand, how many baskets full of fragments took ye up ? And they said , Seven. 21 And he said unto them, How is it that ye do not understand ?
2 Samuel 19:1-43
1 And it was told Joab, Behold, the king weepeth and mourneth for Absalom. 2 And the victory that day was turned into mourning unto all the people: for the people heard say that day how the king was grieved for his son. 3 And the people gat them by stealth that day into the city, as people being ashamed steal away when they flee in battle. 4 But the king covered his face, and the king cried with a loud voice, O my son Absalom, O Absalom, my son, my son! 5 And Joab came into the house to the king, and said , Thou hast shamed this day the faces of all thy servants, which this day have saved thy life, and the lives of thy sons and of thy daughters, and the lives of thy wives, and the lives of thy concubines; 6 In that thou lovest thine enemies , and hatest thy friends . For thou hast declared this day, that thou regardest neither princes nor servants: for this day I perceive , that if Absalom had lived, and all we had died this day, then it had pleased thee well . 7 Now therefore arise , go forth , and speak comfortably unto thy servants: for I swear by the LORD, if thou go not forth , there will not tarry one with thee this night: and that will be worse unto thee than all the evil that befell thee from thy youth until now. 8 Then the king arose , and sat in the gate. And they told unto all the people, saying , Behold, the king doth sit in the gate. And all the people came before the king: for Israel had fled every man to his tent. 9 And all the people were at strife throughout all the tribes of Israel, saying , The king saved us out of the hand of our enemies , and he delivered us out of the hand of the Philistines; and now he is fled out of the land for Absalom. 10 And Absalom, whom we anointed over us, is dead in battle. Now therefore why speak ye not a word of bringing the king back ? 11 And king David sent to Zadok and to Abiathar the priests, saying , Speak unto the elders of Judah, saying , Why are ye the last to bring the king back to his house? seeing the speech of all Israel is come to the king, even to his house. 12 Ye are my brethren, ye are my bones and my flesh: wherefore then are ye the last to bring back the king? 13 And say ye to Amasa, Art thou not of my bone, and of my flesh? God do so to me, and more also, if thou be not captain of the host before me continually in the room of Joab. 14 And he bowed the heart of all the men of Judah, even as the heart of one man; so that they sent this word unto the king, Return thou, and all thy servants. 15 So the king returned , and came to Jordan. And Judah came to Gilgal, to go to meet the king, to conduct the king over Jordan. 16 And Shimei the son of Gera, a Benjamite, which was of Bahurim, hasted and came down with the men of Judah to meet king David. 17 And there were a thousand men of Benjamin with him, and Ziba the servant of the house of Saul, and his fifteen sons and his twenty servants with him; and they went over Jordan before the king. 18 And there went over a ferry boat to carry over the king's household, and to do what he thought good. And Shimei the son of Gera fell down before the king, as he was come over Jordan; 19 And said unto the king, Let not my lord impute iniquity unto me, neither do thou remember that which thy servant did perversely the day that my lord the king went out of Jerusalem, that the king should take it to his heart. 20 For thy servant doth know that I have sinned : therefore, behold, I am come the first this day of all the house of Joseph to go down to meet my lord the king. 21 But Abishai the son of Zeruiah answered and said , Shall not Shimei be put to death for this, because he cursed the LORD'S anointed? 22 And David said , What have I to do with you, ye sons of Zeruiah, that ye should this day be adversaries unto me? shall there any man be put to death this day in Israel? for do not I know that I am this day king over Israel? 23 Therefore the king said unto Shimei, Thou shalt not die . And the king sware unto him. 24 And Mephibosheth the son of Saul came down to meet the king, and had neither dressed his feet, nor trimmed his beard, nor washed his clothes, from the day the king departed until the day he came again in peace. 25 And it came to pass, when he was come to Jerusalem to meet the king, that the king said unto him, Wherefore wentest not thou with me, Mephibosheth? 26 And he answered , My lord, O king, my servant deceived me: for thy servant said , I will saddle me an ass, that I may ride thereon, and go to the king; because thy servant is lame. 27 And he hath slandered thy servant unto my lord the king; but my lord the king is as an angel of God: do therefore what is good in thine eyes. 28 For all of my father's house were but dead men before my lord the king: yet didst thou set thy servant among them that did eat at thine own table. What right therefore have I yet to cry any more unto the king? 29 And the king said unto him, Why speakest thou any more of thy matters? I have said , Thou and Ziba divide the land. 30 And Mephibosheth said unto the king, Yea, let him take all, forasmuch as my lord the king is come again in peace unto his own house. 31 And Barzillai the Gileadite came down from Rogelim, and went over Jordan with the king, to conduct him over Jordan. 32 Now Barzillai was a very aged man, even fourscore years old: and he had provided the king of sustenance while he lay at Mahanaim; for he was a very great man. 33 And the king said unto Barzillai, Come thou over with me, and I will feed thee with me in Jerusalem. 34 And Barzillai said unto the king, How long have I to live , that I should go up with the king unto Jerusalem? 35 I am this day fourscore years old: and can I discern between good and evil? can thy servant taste what I eat or what I drink ? can I hear any more the voice of singing men and singing women ? wherefore then should thy servant be yet a burden unto my lord the king? 36 Thy servant will go a little way over Jordan with the king: and why should the king recompense it me with such a reward? 37 Let thy servant, I pray thee, turn back again , that I may die in mine own city, and be buried by the grave of my father and of my mother. But behold thy servant Chimham; let him go over with my lord the king; and do to him what shall seem good unto thee. 38 And the king answered , Chimham shall go over with me, and I will do to him that which shall seem good unto thee: and whatsoever thou shalt require of me, that will I do for thee. 39 And all the people went over Jordan. And when the king was come over , the king kissed Barzillai, and blessed him; and he returned unto his own place. 40 Then the king went on to Gilgal, and Chimham went on with him: and all the people of Judah conducted the king, and also half the people of Israel. 41 And, behold, all the men of Israel came to the king, and said unto the king, Why have our brethren the men of Judah stolen thee away , and have brought the king, and his household, and all David's men with him, over Jordan? 42 And all the men of Judah answered the men of Israel, Because the king is near of kin to us: wherefore then be ye angry for this matter? have we eaten at all of the king's cost? or hath he given us any gift? 43 And the men of Israel answered the men of Judah, and said , We have ten parts in the king, and we have also more right in David than ye: why then did ye despise us, that our advice should not be first had in bringing back our king? And the words of the men of Judah were fiercer than the words of the men of Israel.
Daniel 12:1-13
1 And at that time shall Michael stand up , the great prince which standeth for the children of thy people: and there shall be a time of trouble, such as never was since there was a nation even to that same time: and at that time thy people shall be delivered , every one that shall be found written in the book. 2 And many of them that sleep in the dust of the earth shall awake , some to everlasting life, and some to shame and everlasting contempt. 3 And they that be wise shall shine as the brightness of the firmament; and they that turn many to righteousness as the stars for ever and ever. 4 But thou, O Daniel, shut up the words, and seal the book, even to the time of the end: many shall run to and fro , and knowledge shall be increased . 5 Then I Daniel looked , and, behold, there stood other two, the one on this side of the bank of the river, and the other on that side of the bank of the river. 6 And one said to the man clothed in linen, which was upon the waters of the river, How long shall it be to the end of these wonders? 7 And I heard the man clothed in linen, which was upon the waters of the river, when he held up his right hand and his left hand unto heaven, and sware by him that liveth for ever that it shall be for a time, times, and an half; and when he shall have accomplished to scatter the power of the holy people, all these things shall be finished . 8 And I heard , but I understood not: then said I, O my Lord, what shall be the end of these things? 9 And he said , Go thy way , Daniel: for the words are closed up and sealed till the time of the end. 10 Many shall be purified , and made white , and tried ; but the wicked shall do wickedly : and none of the wicked shall understand ; but the wise shall understand . 11 And from the time that the daily sacrifice shall be taken away , and the abomination that maketh desolate set up , there shall be a thousand two hundred and ninety days. 12 Blessed is he that waiteth , and cometh to the thousand three hundred and five and thirty days. 13 But go thou thy way till the end be: for thou shalt rest , and stand in thy lot at the end of the days.
The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Sat 25 Jun 2011, 2:45 pm

June 25, 2011 - King James Version
Mark 7:14-37
14 And when he had called all the people unto him, he said unto them, Hearken unto me every one of you, and understand : 15 There is nothing from without a man, that entering into him can defile him: but the things which come out of him, those are they that defile the man. 16 If any man have ears to hear , let him hear . 17 And when he was entered into the house from the people, his disciples asked him concerning the parable. 18 And he saith unto them, Are ye so without understanding also? Do ye not perceive , that whatsoever thing from without entereth into the man, it cannot defile him; 19 Because it entereth not into his heart, but into the belly, and goeth out into the draught, purging all meats? 20 And he said , That which cometh out of the man, that defileth the man. 21 For from within, out of the heart of men, proceed evil thoughts, adulteries, fornications, murders, 22 Thefts, covetousness, wickedness, deceit, lasciviousness, an evil eye, blasphemy, pride, foolishness: 23 All these evil things come from within, and defile the man. 24 And from thence he arose , and went into the borders of Tyre and Sidon, and entered into an house, and would have no man know it: but he could not be hid . 25 For a certain woman, whose young daughter had an unclean spirit, heard of him, and came and fell at his feet: 26 The woman was a Greek, a Syrophenician by nation; and she besought him that he would cast forth the devil out of her daughter. 27 But Jesus said unto her, Let the children first be filled : for it is not meet to take the children's bread, and to cast it unto the dogs. 28 And she answered and said unto him, Yes, Lord: yet the dogs under the table eat of the children's crumbs. 29 And he said unto her, For this saying go thy way ; the devil is gone out of thy daughter. 30 And when she was come to her house, she found the devil gone out , and her daughter laid upon the bed. 31 And again, departing from the coasts of Tyre and Sidon, he came unto the sea of Galilee, through the midst of the coasts of Decapolis. 32 And they bring unto him one that was deaf, and had an impediment in his speech; and they beseech him to put his hand upon him. 33 And he took him aside from the multitude, and put his fingers into his ears, and he spit , and touched his tongue; 34 And looking up to heaven, he sighed , and saith unto him, Ephphatha, that is, Be opened . 35 And straightway his ears were opened , and the string of his tongue was loosed , and he spake plain. 36 And he charged them that they should tell no man: but the more he charged them, so much the more a great deal they published it; 37 And were beyond measure astonished , saying , He hath done all things well: he maketh both the deaf to hear , and the dumb to speak . 2 Samuel 18:1-33
1 And David numbered the people that were with him, and set captains of thousands and captains of hundreds over them. 2 And David sent forth a third part of the people under the hand of Joab, and a third part under the hand of Abishai the son of Zeruiah, Joab's brother, and a third part under the hand of Ittai the Gittite. And the king said unto the people, I will surely go forth with you myself also. 3 But the people answered , Thou shalt not go forth : for if we flee away , they will not care for us; neither if half of us die , will they care for us: but now thou art worth ten thousand of us: therefore now it is better that thou succour us out of the city. 4 And the king said unto them, What seemeth you best I will do . And the king stood by the gate side, and all the people came out by hundreds and by thousands. 5 And the king commanded Joab and Abishai and Ittai, saying , Deal gently for my sake with the young man, even with Absalom. And all the people heard when the king gave all the captains charge concerning Absalom. 6 So the people went out into the field against Israel: and the battle was in the wood of Ephraim; 7 Where the people of Israel were slain before the servants of David, and there was there a great slaughter that day of twenty thousand men. 8 For the battle was there scattered over the face of all the country: and the wood devoured more people that day than the sword devoured . 9 And Absalom met the servants of David. And Absalom rode upon a mule, and the mule went under the thick boughs of a great oak, and his head caught hold of the oak, and he was taken up between the heaven and the earth; and the mule that was under him went away . 10 And a certain man saw it, and told Joab, and said , Behold, I saw Absalom hanged in an oak. 11 And Joab said unto the man that told him, And, behold, thou sawest him, and why didst thou not smite him there to the ground? and I would have given thee ten shekels of silver, and a girdle. 12 And the man said unto Joab, Though I should receive a thousand shekels of silver in mine hand, yet would I not put forth mine hand against the king's son: for in our hearing the king charged thee and Abishai and Ittai, saying , Beware that none touch the young man Absalom. 13 Otherwise I should have wrought falsehood against mine own life: for there is no matter hid from the king, and thou thyself wouldest have set thyself against me. 14 Then said Joab, I may not tarry thus with thee. And he took three darts in his hand, and thrust them through the heart of Absalom, while he was yet alive in the midst of the oak. 15 And ten young men that bare Joab's armour compassed about and smote Absalom, and slew him. 16 And Joab blew the trumpet, and the people returned from pursuing after Israel: for Joab held back the people. 17 And they took Absalom, and cast him into a great pit in the wood, and laid a very great heap of stones upon him: and all Israel fled every one to his tent. 18 Now Absalom in his lifetime had taken and reared up for himself a pillar, which is in the king's dale: for he said , I have no son to keep my name in remembrance : and he called the pillar after his own name: and it is called unto this day, Absalom's place. 19 Then said Ahimaaz the son of Zadok, Let me now run , and bear the king tidings , how that the LORD hath avenged him of his enemies . 20 And Joab said unto him, Thou shalt not bear tidings this day, but thou shalt bear tidings another day: but this day thou shalt bear no tidings , because the king's son is dead . 21 Then said Joab to Cushi, Go tell the king what thou hast seen . And Cushi bowed himself unto Joab, and ran . 22 Then said Ahimaaz the son of Zadok yet again to Joab, But howsoever, let me, I pray thee, also run after Cushi. And Joab said , Wherefore wilt thou run , my son, seeing that thou hast no tidings ready ? 23 But howsoever, said he, let me run . And he said unto him, Run . Then Ahimaaz ran by the way of the plain, and overran Cushi. 24 And David sat between the two gates: and the watchman went up to the roof over the gate unto the wall, and lifted up his eyes, and looked , and behold a man running alone. 25 And the watchman cried , and told the king. And the king said , If he be alone, there is tidings in his mouth. And he came apace , and drew near. 26 And the watchman saw another man running : and the watchman called unto the porter, and said , Behold another man running alone. And the king said , He also bringeth tidings . 27 And the watchman said , Me thinketh the running of the foremost is like the running of Ahimaaz the son of Zadok. And the king said , He is a good man, and cometh with good tidings. 28 And Ahimaaz called , and said unto the king, All is well. And he fell down to the earth upon his face before the king, and said , Blessed be the LORD thy God, which hath delivered up the men that lifted up their hand against my lord the king. 29 And the king said , Is the young man Absalom safe? And Ahimaaz answered , When Joab sent the king's servant, and me thy servant, I saw a great tumult, but I knew not what it was. 30 And the king said unto him, Turn aside , and stand here. And he turned aside , and stood still . 31 And, behold, Cushi came ; and Cushi said , Tidings , my lord the king: for the LORD hath avenged thee this day of all them that rose up against thee. 32 And the king said unto Cushi, Is the young man Absalom safe? And Cushi answered , The enemies of my lord the king, and all that rise against thee to do thee hurt, be as that young man is. 33 And the king was much moved , and went up to the chamber over the gate, and wept : and as he went , thus he said , O my son Absalom, my son, my son Absalom! would God I had died for thee , O Absalom, my son, my son! Daniel 11:21-45
21 And in his estate shall stand up a vile person , to whom they shall not give the honour of the kingdom: but he shall come in peaceably, and obtain the kingdom by flatteries. 22 And with the arms of a flood shall they be overflown from before him, and shall be broken ; yea, also the prince of the covenant. 23 And after the league made with him he shall work deceitfully: for he shall come up , and shall become strong with a small people. 24 He shall enter peaceably even upon the fattest places of the province; and he shall do that which his fathers have not done , nor his fathers' fathers; he shall scatter among them the prey, and spoil, and riches: yea, and he shall forecast his devices against the strong holds, even for a time. 25 And he shall stir up his power and his courage against the king of the south with a great army; and the king of the south shall be stirred up to battle with a very great and mighty army; but he shall not stand : for they shall forecast devices against him. 26 Yea, they that feed of the portion of his meat shall destroy him, and his army shall overflow : and many shall fall down slain. 27 And both these kings' hearts shall be to do mischief , and they shall speak lies at one table; but it shall not prosper : for yet the end shall be at the time appointed. 28 Then shall he return into his land with great riches; and his heart shall be against the holy covenant; and he shall do exploits, and return to his own land. 29 At the time appointed he shall return , and come toward the south; but it shall not be as the former, or as the latter. 30 For the ships of Chittim shall come against him: therefore he shall be grieved , and return , and have indignation against the holy covenant: so shall he do ; he shall even return , and have intelligence with them that forsake the holy covenant. 31 And arms shall stand on his part, and they shall pollute the sanctuary of strength, and shall take away the daily sacrifice, and they shall place the abomination that maketh desolate . 32 And such as do wickedly against the covenant shall he corrupt by flatteries: but the people that do know their God shall be strong , and do exploits. 33 And they that understand among the people shall instruct many: yet they shall fall by the sword, and by flame, by captivity, and by spoil, many days. 34 Now when they shall fall , they shall be holpen with a little help: but many shall cleave to them with flatteries. 35 And some of them of understanding shall fall , to try them, and to purge , and to make them white , even to the time of the end: because it is yet for a time appointed. 36 And the king shall do according to his will; and he shall exalt himself, and magnify himself above every god, and shall speak marvellous things against the God of gods, and shall prosper till the indignation be accomplished : for that that is determined shall be done . 37 Neither shall he regard the God of his fathers, nor the desire of women, nor regard any god: for he shall magnify himself above all. 38 But in his estate shall he honour the God of forces: and a god whom his fathers knew not shall he honour with gold, and silver, and with precious stones, and pleasant things. 39 Thus shall he do in the most strong holds with a strange god, whom he shall acknowledge and increase with glory: and he shall cause them to rule over many, and shall divide the land for gain. 40 And at the time of the end shall the king of the south push at him: and the king of the north shall come against him like a whirlwind , with chariots, and with horsemen, and with many ships; and he shall enter into the countries, and shall overflow and pass over . 41 He shall enter also into the glorious land, and many countries shall be overthrown : but these shall escape out of his hand, even Edom, and Moab, and the chief of the children of Ammon. 42 He shall stretch forth his hand also upon the countries: and the land of Egypt shall not escape. 43 But he shall have power over the treasures of gold and of silver, and over all the precious things of Egypt: and the Libyans and the Ethiopians shall be at his steps. 44 But tidings out of the east and out of the north shall trouble him: therefore he shall go forth with great fury to destroy , and utterly to make away many. 45 And he shall plant the tabernacles of his palace between the seas in the glorious holy mountain; yet he shall come to his end, and none shall help him. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Fri 24 Jun 2011, 3:57 pm

Daily Bible Reading from BibleStudyTools.com
June 24, 2011 - King James Version
Mark 7:1-13
1 Then came together unto him the Pharisees, and certain of the scribes, which came from Jerusalem. 2 And when they saw some of his disciples eat bread with defiled, that is to say , with unwashen, hands, they found fault . 3 For the Pharisees, and all the Jews, except they wash their hands oft, eat not, holding the tradition of the elders. 4 And when they come from the market, except they wash , they eat not. And many other things there be , which they have received to hold , as the washing of cups, and pots , brasen vessels, and of tables. 5 Then the Pharisees and scribes asked him, Why walk not thy disciples according to the tradition of the elders, but eat bread with unwashen hands? 6 He answered and said unto them , Well hath Esaias prophesied of you hypocrites, as it is written , This people honoureth me with their lips, but their heart is far from me. 7 Howbeit in vain do they worship me, teaching for doctrines the commandments of men. 8 For laying aside the commandment of God, ye hold the tradition of men, as the washing of pots and cups: and many other such like things ye do . 9 And he said unto them, Full well ye reject the commandment of God, that ye may keep your own tradition. 10 For Moses said , Honour thy father and thy mother; and, Whoso curseth father or mother, let him die the death: 11 But ye say , If a man shall say to his father or mother, It is Corban, that is to say, a gift, by whatsoever thou mightest be profited by me; he shall be free. 12 And ye suffer him no more to do ought for his father or his mother; 13 Making the word of God of none effect through your tradition, which ye have delivered : and many such like things do ye . 2 Samuel 17:1-29
1 Moreover Ahithophel said unto Absalom, Let me now choose out twelve thousand men, and I will arise and pursue after David this night: 2 And I will come upon him while he is weary and weak handed, and will make him afraid : and all the people that are with him shall flee ; and I will smite the king only: 3 And I will bring back all the people unto thee: the man whom thou seekest is as if all returned : so all the people shall be in peace. 4 And the saying pleased Absalom well, and all the elders of Israel. 5 Then said Absalom, Call now Hushai the Archite also, and let us hear likewise what he saith. 6 And when Hushai was come to Absalom, Absalom spake unto him, saying , Ahithophel hath spoken after this manner: shall we do after his saying? if not; speak thou. 7 And Hushai said unto Absalom, The counsel that Ahithophel hath given is not good at this time. 8 For, said Hushai, thou knowest thy father and his men, that they be mighty men, and they be chafed in their minds, as a bear robbed of her whelps in the field: and thy father is a man of war, and will not lodge with the people. 9 Behold, he is hid now in some pit, or in some other place: and it will come to pass, when some of them be overthrown at the first, that whosoever heareth it will say , There is a slaughter among the people that follow Absalom. 10 And he also that is valiant , whose heart is as the heart of a lion, shall utterly melt : for all Israel knoweth that thy father is a mighty man, and they which be with him are valiant men. 11 Therefore I counsel that all Israel be generally gathered unto thee, from Dan even to Beersheba, as the sand that is by the sea for multitude; and that thou go to battle in thine own person. 12 So shall we come upon him in some place where he shall be found , and we will light upon him as the dew falleth on the ground: and of him and of all the men that are with him there shall not be left so much as one. 13 Moreover, if he be gotten into a city, then shall all Israel bring ropes to that city, and we will draw it into the river, until there be not one small stone found there. 14 And Absalom and all the men of Israel said , The counsel of Hushai the Archite is better than the counsel of Ahithophel. For the LORD had appointed to defeat the good counsel of Ahithophel, to the intent that the LORD might bring evil upon Absalom. 15 Then said Hushai unto Zadok and to Abiathar the priests, Thus and thus did Ahithophel counsel Absalom and the elders of Israel; and thus and thus have I counselled . 16 Now therefore send quickly, and tell David, saying , Lodge not this night in the plains of the wilderness, but speedily pass over ; lest the king be swallowed up , and all the people that are with him. 17 Now Jonathan and Ahimaaz stayed by Enrogel; for they might not be seen to come into the city: and a wench went and told them; and they went and told king David. 18 Nevertheless a lad saw them, and told Absalom: but they went both of them away quickly, and came to a man's house in Bahurim, which had a well in his court; whither they went down . 19 And the woman took and spread a covering over the well's mouth, and spread ground corn thereon; and the thing was not known . 20 And when Absalom's servants came to the woman to the house, they said , Where is Ahimaaz and Jonathan? And the woman said unto them, They be gone over the brook of water. And when they had sought and could not find them, they returned to Jerusalem. 21 And it came to pass, after they were departed , that they came up out of the well, and went and told king David, and said unto David, Arise , and pass quickly over the water: for thus hath Ahithophel counselled against you. 22 Then David arose , and all the people that were with him, and they passed over Jordan: by the morning light there lacked not one of them that was not gone over Jordan. 23 And when Ahithophel saw that his counsel was not followed , he saddled his ass, and arose , and gat him home to his house, to his city, and put his household in order , and hanged himself, and died , and was buried in the sepulchre of his father. 24 Then David came to Mahanaim. And Absalom passed over Jordan, he and all the men of Israel with him. 25 And Absalom made Amasa captain of the host instead of Joab: which Amasa was a man's son, whose name was Ithra an Israelite, that went in to Abigail the daughter of Nahash, sister to Zeruiah Joab's mother. 26 So Israel and Absalom pitched in the land of Gilead. 27 And it came to pass, when David was come to Mahanaim, that Shobi the son of Nahash of Rabbah of the children of Ammon, and Machir the son of Ammiel of Lodebar, and Barzillai the Gileadite of Rogelim, 28 Brought beds, and basons, and earthen vessels, and wheat, and barley, and flour, and parched corn, and beans, and lentiles, and parched pulse, 29 And honey, and butter, and sheep, and cheese of kine, for David, and for the people that were with him, to eat : for they said , The people is hungry, and weary, and thirsty, in the wilderness. Daniel 11:1-19
1 Also I in the first year of Darius the Mede, even I, stood to confirm and to strengthen him. 2 And now will I shew thee the truth. Behold, there shall stand up yet three kings in Persia; and the fourth shall be far richer than they all: and by his strength through his riches he shall stir up all against the realm of Grecia. 3 And a mighty king shall stand up , that shall rule with great dominion, and do according to his will. 4 And when he shall stand up , his kingdom shall be broken , and shall be divided toward the four winds of heaven; and not to his posterity, nor according to his dominion which he ruled : for his kingdom shall be plucked up , even for others beside those. 5 And the king of the south shall be strong , and one of his princes; and he shall be strong above him, and have dominion ; his dominion shall be a great dominion. 6 And in the end of years they shall join themselves together ; for the king's daughter of the south shall come to the king of the north to make an agreement: but she shall not retain the power of the arm; neither shall he stand , nor his arm: but she shall be given up , and they that brought her, and he that begat her, and he that strengthened her in these times. 7 But out of a branch of her roots shall one stand up in his estate, which shall come with an army, and shall enter into the fortress of the king of the north, and shall deal against them, and shall prevail : 8 And shall also carry captives into Egypt their gods, with their princes, and with their precious vessels of silver and of gold; and he shall continue more years than the king of the north. 9 So the king of the south shall come into his kingdom, and shall return into his own land. 10 But his sons shall be stirred up , and shall assemble a multitude of great forces: and one shall certainly come , and overflow , and pass through : then shall he return , and be stirred up , even to his fortress. 11 And the king of the south shall be moved with choler , and shall come forth and fight with him, even with the king of the north: and he shall set forth a great multitude; but the multitude shall be given into his hand. 12 And when he hath taken away the multitude, his heart shall be lifted up ; and he shall cast down many ten thousands: but he shall not be strengthened by it. 13 For the king of the north shall return , and shall set forth a multitude greater than the former, and shall certainly come after certain years with a great army and with much riches. 14 And in those times there shall many stand up against the king of the south: also the robbers of thy people shall exalt themselves to establish the vision; but they shall fall . 15 So the king of the north shall come , and cast up a mount, and take the most fenced cities: and the arms of the south shall not withstand , neither his chosen people, neither shall there be any strength to withstand . 16 But he that cometh against him shall do according to his own will, and none shall stand before him: and he shall stand in the glorious land, which by his hand shall be consumed. 17 He shall also set his face to enter with the strength of his whole kingdom, and upright ones with him; thus shall he do : and he shall give him the daughter of women, corrupting her: but she shall not stand on his side, neither be for him. 18 After this shall he turn his face unto the isles, and shall take many: but a prince for his own behalf shall cause the reproach offered by him to cease ; without his own reproach he shall cause it to turn upon him. 19 Then he shall turn his face toward the fort of his own land: but he shall stumble and fall , and not be found . The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.
DAILY BIBLE READING from BIBLE STUDY TOOLS.COM - Page 38 Zbfwmdrlwzwkrfltkbjqgkvgrdkfpjjfzsrgmmtmzmssprp_twpvzlwhvvpm

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Admin on Thu 23 Jun 2011, 10:39 pm

Daily Bible Reading from BibleStudyTools.com
June 23, 2011 - King James Version
Mark 6:30-56
30 And the apostles gathered themselves together unto Jesus, and told him all things, both what they had done , and what they had taught . 31 And he said unto them, Come ye yourselves apart into a desert place, and rest a while: for there were many coming and going , and they had no leisure so much as to eat . 32 And they departed into a desert place by ship privately . 33 And the people saw them departing , and many knew him, and ran afoot thither out of all cities, and outwent them, and came together unto him. 34 And Jesus, when he came out , saw much people, and was moved with compassion toward them, because they were as sheep not having a shepherd: and he began to teach them many things. 35 And when the day was now far spent, his disciples came unto him, and said , This is a desert place, and now the time is far passed: 36 Send them away , that they may go into the country round about, and into the villages, and buy themselves bread: for they have nothing to eat . 37 He answered and said unto them, Give ye them to eat . And they say unto him, Shall we go and buy two hundred pennyworth of bread, and give them to eat ? 38 He saith unto them, How many loaves have ye ? go and see . And when they knew , they say , Five, and two fishes. 39 And he commanded them to make all sit down by companies upon the green grass. 40 And they sat down in ranks , by hundreds, and by fifties. 41 And when he had taken the five loaves and the two fishes, he looked up to heaven, and blessed , and brake the loaves, and gave them to his disciples to set before them; and the two fishes divided he among them all. 42 And they did all eat , and were filled . 43 And they took up twelve baskets full of the fragments, and of the fishes. 44 And they that did eat of the loaves were about five thousand men. 45 And straightway he constrained his disciples to get into the ship, and to go to the other side before unto Bethsaida, while he sent away the people. 46 And when he had sent them away , he departed into a mountain to pray . 47 And when even was come , the ship was in the midst of the sea, and he alone on the land. 48 And he saw them toiling in rowing ; for the wind was contrary unto them: and about the fourth watch of the night he cometh unto them, walking upon the sea, and would have passed by them. 49 But when they saw him walking upon the sea, they supposed it had been a spirit, and cried out : 50 For they all saw him, and were troubled . And immediately he talked with them, and saith unto them, Be of good cheer : it is I; be not afraid . 51 And he went up unto them into the ship; and the wind ceased : and they were sore amazed in themselves beyond measure, and wondered . 52 For they considered not the miracle of the loaves: for their heart was hardened . 53 And when they had passed over , they came into the land of Gennesaret, and drew to the shore . 54 And when they were come out of the ship, straightway they knew him, 55 And ran through that whole region round about, and began to carry about in beds those that were sick, where they heard he was . 56 And whithersoever he entered , into villages, or cities, or country, they laid the sick in the streets, and besought him that they might touch if it were but the border of his garment: and as many as touched him were made whole . 2 Samuel 16:1-23
1 And when David was a little past the top of the hill, behold, Ziba the servant of Mephibosheth met him, with a couple of asses saddled , and upon them two hundred loaves of bread, and an hundred bunches of raisins, and an hundred of summer fruits, and a bottle of wine. 2 And the king said unto Ziba, What meanest thou by these? And Ziba said , The asses be for the king's household to ride on ; and the bread and summer fruit for the young men to eat ; and the wine, that such as be faint in the wilderness may drink . 3 And the king said , And where is thy master's son? And Ziba said unto the king, Behold, he abideth at Jerusalem: for he said , To day shall the house of Israel restore me the kingdom of my father. 4 Then said the king to Ziba, Behold, thine are all that pertained unto Mephibosheth. And Ziba said , I humbly beseech thee that I may find grace in thy sight, my lord, O king. 5 And when king David came to Bahurim, behold, thence came out a man of the family of the house of Saul, whose name was Shimei, the son of Gera: he came forth , and cursed still as he came . 6 And he cast stones at David, and at all the servants of king David: and all the people and all the mighty men were on his right hand and on his left. 7 And thus said Shimei when he cursed , Come out , come out , thou bloody man, and thou man of Belial: 8 The LORD hath returned upon thee all the blood of the house of Saul, in whose stead thou hast reigned ; and the LORD hath delivered the kingdom into the hand of Absalom thy son: and, behold, thou art taken in thy mischief, because thou art a bloody man. 9 Then said Abishai the son of Zeruiah unto the king, Why should this dead dog curse my lord the king? let me go over , I pray thee, and take off his head. 10 And the king said , What have I to do with you, ye sons of Zeruiah? so let him curse , because the LORD hath said unto him, Curse David. Who shall then say , Wherefore hast thou done so ? 11 And David said to Abishai, and to all his servants, Behold, my son, which came forth of my bowels, seeketh my life: how much more now may this Benjamite do it? let him alone , and let him curse ; for the LORD hath bidden him. 12 It may be that the LORD will look on mine affliction , and that the LORD will requite me good for his cursing this day. 13 And as David and his men went by the way, Shimei went along on the hill's side over against him, and cursed as he went , and threw stones at him, and cast dust. 14 And the king, and all the people that were with him, came weary, and refreshed themselves there. 15 And Absalom, and all the people the men of Israel, came to Jerusalem, and Ahithophel with him. 16 And it came to pass, when Hushai the Archite, David's friend, was come unto Absalom, that Hushai said unto Absalom, God save the king, God save the king. 17 And Absalom said to Hushai, Is this thy kindness to thy friend? why wentest thou not with thy friend? 18 And Hushai said unto Absalom, Nay; but whom the LORD, and this people, and all the men of Israel, choose , his will I be, and with him will I abide . 19 And again, whom should I serve ? should I not serve in the presence of his son? as I have served in thy father's presence, so will I be in thy presence. 20 Then said Absalom to Ahithophel, Give counsel among you what we shall do . 21 And Ahithophel said unto Absalom, Go in unto thy father's concubines, which he hath left to keep the house; and all Israel shall hear that thou art abhorred of thy father: then shall the hands of all that are with thee be strong . 22 So they spread Absalom a tent upon the top of the house; and Absalom went in unto his father's concubines in the sight of all Israel. 23 And the counsel of Ahithophel, which he counselled in those days, was as if a man had enquired at the oracle of God: so was all the counsel of Ahithophel both with David and with Absalom. Daniel 10:1-21
1 In the third year of Cyrus king of Persia a thing was revealed unto Daniel, whose name was called Belteshazzar; and the thing was true, but the time appointed was long: and he understood the thing, and had understanding of the vision. 2 In those days I Daniel was mourning three full weeks. 3 I ate no pleasant bread, neither came flesh nor wine in my mouth, neither did I anoint myself at all , till three whole weeks were fulfilled . 4 And in the four and twentieth day of the first month, as I was by the side of the great river, which is Hiddekel; 5 Then I lifted up mine eyes, and looked , and behold a certain man clothed in linen, whose loins were girded with fine gold of Uphaz: 6 His body also was like the beryl, and his face as the appearance of lightning, and his eyes as lamps of fire, and his arms and his feet like in colour to polished brass, and the voice of his words like the voice of a multitude. 7 And I Daniel alone saw the vision: for the men that were with me saw not the vision; but a great quaking fell upon them, so that they fled to hide themselves. 8 Therefore I was left alone , and saw this great vision, and there remained no strength in me: for my comeliness was turned in me into corruption, and I retained no strength. 9 Yet heard I the voice of his words: and when I heard the voice of his words, then was I in a deep sleep on my face, and my face toward the ground. 10 And, behold, an hand touched me, which set me upon my knees and upon the palms of my hands. 11 And he said unto me, O Daniel, a man greatly beloved, understand the words that I speak unto thee, and stand upright: for unto thee am I now sent . And when he had spoken this word unto me, I stood trembling . 12 Then said he unto me, Fear not, Daniel: for from the first day that thou didst set thine heart to understand , and to chasten thyself before thy God, thy words were heard , and I am come for thy words. 13 But the prince of the kingdom of Persia withstood me one and twenty days: but, lo, Michael, one of the chief princes, came to help me; and I remained there with the kings of Persia. 14 Now I am come to make thee understand what shall befall thy people in the latter days: for yet the vision is for many days. 15 And when he had spoken such words unto me, I set my face toward the ground, and I became dumb . 16 And, behold, one like the similitude of the sons of men touched my lips: then I opened my mouth, and spake , and said unto him that stood before me, O my lord, by the vision my sorrows are turned upon me, and I have retained no strength. 17 For how can the servant of this my lord talk with this my lord? for as for me, straightway there remained no strength in me, neither is there breath left in me. 18 Then there came again and touched me one like the appearance of a man, and he strengthened me, 19 And said , O man greatly beloved, fear not: peace be unto thee, be strong , yea, be strong . And when he had spoken unto me, I was strengthened , and said , Let my lord speak ; for thou hast strengthened me. 20 Then said he, Knowest thou wherefore I come unto thee? and now will I return to fight with the prince of Persia: and when I am gone forth , lo, the prince of Grecia shall come . 21 But I will shew thee that which is noted in the scripture of truth: and there is none that holdeth with me in these things, but Michael your prince. The King James Version is in the public domain.
Find this and more at http://www.biblestudytools.com/.

Posts : 58828
Join date : 2008-10-25
Age : 74
Location : Wales UK

View user profile http://worldwidechristians.forumotion.com

Back to top Go down


Post  Sponsored content

Sponsored content

Back to top Go down

Page 38 of 38 Previous  1 ... 20 ... 36, 37, 38

Back to top

- Similar topics

Permissions in this forum:
You cannot reply to topics in this forum